BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30986 (408 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1F3.04c |||DUF367 family protein|Schizosaccharomyces pombe|c... 29 0.21 SPBP8B7.09c |||karyopherin|Schizosaccharomyces pombe|chr 2|||Manual 26 2.6 SPAC926.09c |fas1||fatty acid synthase beta subunit Fas1|Schizos... 25 6.0 SPBC1778.10c |ppk21|SPBC4C3.11|serine/threonine protein kinase P... 25 6.0 SPAC22A12.12c |||exosome subunit Rrp40 |Schizosaccharomyces pomb... 25 6.0 SPBC15D4.03 |slm9||hira protein Slm9|Schizosaccharomyces pombe|c... 25 6.0 SPBC3B9.15c |scp1||sterol regulatory element binding protein Scp... 25 6.0 SPAC22H10.07 |scd2|ral3|scaffold protein Scd2|Schizosaccharomyce... 25 6.0 SPBC16D10.04c |dna2||DNA replication endonuclease-helicase Dna2|... 24 7.9 SPBC530.02 |||membrane transporter|Schizosaccharomyces pombe|chr... 24 7.9 SPBC28E12.06c |lvs1|SPBC3H7.16|beige protein homolog|Schizosacch... 24 7.9 SPAPB1A10.04c |cwp1||geranylgeranyltransferase I alpha subunit C... 24 7.9 >SPAC1F3.04c |||DUF367 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 288 Score = 29.5 bits (63), Expect = 0.21 Identities = 17/60 (28%), Positives = 35/60 (58%), Gaps = 9/60 (15%) Frame = +3 Query: 72 YFVGFQN-SEVMINRDNWGHSYCDVRGEILG------SSQD--EHQRKHLPKVFSSIKNE 224 Y VG+ N + ++++ WGHS+ +V E+L +QD E ++K+L ++ +S + + Sbjct: 142 YIVGYPNEARLLMDNFKWGHSFFEVNEELLDIYAQCHDAQDIQEKEKKYLEEMEASYQEQ 201 >SPBP8B7.09c |||karyopherin|Schizosaccharomyces pombe|chr 2|||Manual Length = 978 Score = 25.8 bits (54), Expect = 2.6 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 117 NWGHSYCDVRGEILGSSQDEHQRKHLPKVFSSIKNE 224 NW + ++G I SSQ E +L KV SI +E Sbjct: 123 NWNDFFASLQGVIAASSQSEFSNFYL-KVLLSIGDE 157 >SPAC926.09c |fas1||fatty acid synthase beta subunit Fas1|Schizosaccharomyces pombe|chr 1|||Manual Length = 2073 Score = 24.6 bits (51), Expect = 6.0 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +2 Query: 260 VLTVNMSSSDPPTLLQWLGGQLPGNQRF 343 V+++ ++ P +LQW GG+ G+ F Sbjct: 706 VISIAKANPTFPIVLQWTGGRAGGHHSF 733 >SPBC1778.10c |ppk21|SPBC4C3.11|serine/threonine protein kinase Ppk21|Schizosaccharomyces pombe|chr 2|||Manual Length = 550 Score = 24.6 bits (51), Expect = 6.0 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = -2 Query: 80 NKIEPRSYSIIPCTKYSSSIFSP 12 N ++P+S +++P T + SI SP Sbjct: 29 NPVKPQSSNVVPGTSHIGSIKSP 51 >SPAC22A12.12c |||exosome subunit Rrp40 |Schizosaccharomyces pombe|chr 1|||Manual Length = 240 Score = 24.6 bits (51), Expect = 6.0 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +2 Query: 296 TLLQWLGGQLPGNQRFWTPGGVWLQS*NL 382 TLLQ LG +P G VW+ S NL Sbjct: 180 TLLQTLGSYIPFEIAVGMNGRVWVNSENL 208 >SPBC15D4.03 |slm9||hira protein Slm9|Schizosaccharomyces pombe|chr 2|||Manual Length = 807 Score = 24.6 bits (51), Expect = 6.0 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +2 Query: 56 NMISVLFCWFSELRGND 106 N +S+L C FS L GND Sbjct: 476 NQLSLLKCTFSNLDGND 492 >SPBC3B9.15c |scp1||sterol regulatory element binding protein Scp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1086 Score = 24.6 bits (51), Expect = 6.0 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +1 Query: 256 PSSNRKYVI*RSADVTTMARRAASGKPKILDSGGSMVAKLKLKGIDGRA 402 P++NR + S +VT +++ PKIL + + + K K I G A Sbjct: 749 PTANRIACLTESGEVTVYSKKGPVWSPKILSQNKNYLTETK-KDIYGIA 796 >SPAC22H10.07 |scd2|ral3|scaffold protein Scd2|Schizosaccharomyces pombe|chr 1|||Manual Length = 536 Score = 24.6 bits (51), Expect = 6.0 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -2 Query: 401 ALPSIPLSFSFATILPPESKIFGFPEAA 318 ALP PLSFS P ++ PE+A Sbjct: 425 ALPREPLSFSLPEKAPEKATNISIPESA 452 >SPBC16D10.04c |dna2||DNA replication endonuclease-helicase Dna2|Schizosaccharomyces pombe|chr 2|||Manual Length = 1398 Score = 24.2 bits (50), Expect = 7.9 Identities = 8/34 (23%), Positives = 18/34 (52%) Frame = +3 Query: 63 SRFYFVGFQNSEVMINRDNWGHSYCDVRGEILGS 164 S+ F+G ++ I++D + +RG ++ S Sbjct: 865 SKLSFIGSNHTRYRIDKDEFSSGIASIRGTLMSS 898 >SPBC530.02 |||membrane transporter|Schizosaccharomyces pombe|chr 2|||Manual Length = 541 Score = 24.2 bits (50), Expect = 7.9 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -1 Query: 333 FPGSCPPSHCSNVGGSLDDIFT 268 F GS P S+C GG+L D+FT Sbjct: 200 FFGSTPLSNC---GGTLSDLFT 218 >SPBC28E12.06c |lvs1|SPBC3H7.16|beige protein homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 2609 Score = 24.2 bits (50), Expect = 7.9 Identities = 6/20 (30%), Positives = 17/20 (85%) Frame = -2 Query: 167 RRSKNFTSNVAIRMPPVIPI 108 + SK++ +N ++++PP++P+ Sbjct: 558 KTSKSYKTNDSLKVPPLVPL 577 >SPAPB1A10.04c |cwp1||geranylgeranyltransferase I alpha subunit Cwp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 294 Score = 24.2 bits (50), Expect = 7.9 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = -1 Query: 396 SVNSFKFQLCNHTPPGVQN 340 +V +++FQ+ NHTP + N Sbjct: 77 TVWAYRFQILNHTPSYIDN 95 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,668,695 Number of Sequences: 5004 Number of extensions: 31079 Number of successful extensions: 103 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 97 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 103 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 140222766 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -