BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30986 (408 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17617| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 5e-12 SB_57691| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-10 SB_6465| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-10 SB_2383| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-10 SB_27342| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-10 SB_58054| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 2e-09 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_33624| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_6881| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 4e-05 SB_26327| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_1546| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_13730| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_35396| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.6 SB_35857| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_19517| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_15898| Best HMM Match : Fork_head (HMM E-Value=0) 28 3.4 SB_23259| Best HMM Match : zf-C2H2 (HMM E-Value=0) 27 4.5 SB_42296| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.9 SB_42285| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.9 SB_55801| Best HMM Match : EPTP (HMM E-Value=0.24) 27 7.8 >SB_17617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 67.3 bits (157), Expect = 5e-12 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = +2 Query: 155 SWIVARRTSAKAFAKGVFINQERKLEVRRRLDTALVLTVN 274 SWI RRT+AKAFAK VFINQERKLE RRR DT LVLT+N Sbjct: 4 SWIYERRTTAKAFAKNVFINQERKLEDRRRSDTVLVLTIN 43 >SB_57691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 60.5 bits (140), Expect = 5e-10 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +2 Query: 170 RRTSAKAFAKGVFINQERKLEVRRRLDTALVLTVN 274 RRT+AKAFAK VFINQERKLE RRR DT LVLT+N Sbjct: 9 RRTTAKAFAKNVFINQERKLEDRRRSDTVLVLTIN 43 >SB_6465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 60.5 bits (140), Expect = 5e-10 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +2 Query: 170 RRTSAKAFAKGVFINQERKLEVRRRLDTALVLTVN 274 RRT+AKAFAK VFINQERKLE RRR DT LVLT+N Sbjct: 9 RRTTAKAFAKNVFINQERKLEDRRRSDTVLVLTIN 43 >SB_2383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 60.5 bits (140), Expect = 5e-10 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +2 Query: 170 RRTSAKAFAKGVFINQERKLEVRRRLDTALVLTVN 274 RRT+AKAFAK VFINQERKLE RRR DT LVLT+N Sbjct: 9 RRTTAKAFAKNVFINQERKLEDRRRSDTVLVLTIN 43 >SB_27342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 48 Score = 60.5 bits (140), Expect = 5e-10 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +2 Query: 170 RRTSAKAFAKGVFINQERKLEVRRRLDTALVLTVN 274 RRT+AKAFAK VFINQERKLE RRR DT LVLT+N Sbjct: 11 RRTTAKAFAKNVFINQERKLEDRRRSDTVLVLTIN 45 >SB_58054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 58.4 bits (135), Expect = 2e-09 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +2 Query: 173 RTSAKAFAKGVFINQERKLEVRRRLDTALVLTVN 274 RT+AKAFAK VFINQERKLE RRR DT LVLT+N Sbjct: 29 RTTAKAFAKNVFINQERKLEDRRRSDTVLVLTIN 62 >SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 48.0 bits (109), Expect = 3e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +2 Query: 173 RTSAKAFAKGVFINQERKLEVRRRLDT 253 RT+AKAFAK VFINQERKLE RRR DT Sbjct: 2 RTTAKAFAKNVFINQERKLEDRRRSDT 28 >SB_33624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 48.0 bits (109), Expect = 3e-06 Identities = 24/36 (66%), Positives = 29/36 (80%), Gaps = 1/36 (2%) Frame = +2 Query: 170 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVLTVN 274 R+T+ ++ AK VFINQERKLE RRR DT LVLT+N Sbjct: 8 RKTNYCESIAKNVFINQERKLEDRRRSDTVLVLTIN 43 Score = 29.5 bits (63), Expect = 1.1 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 148 VKFLDRRKTNISESICQRCFHQSRTKV 228 VKFLD RKTN ESI + F K+ Sbjct: 2 VKFLDLRKTNYCESIAKNVFINQERKL 28 >SB_6881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 44.4 bits (100), Expect = 4e-05 Identities = 22/36 (61%), Positives = 28/36 (77%), Gaps = 1/36 (2%) Frame = +2 Query: 170 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVLTVN 274 R+T+ ++ + VFINQERKLE RRR DT LVLT+N Sbjct: 8 RKTNYCESICQDVFINQERKLEDRRRSDTVLVLTIN 43 Score = 33.9 bits (74), Expect = 0.052 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = +1 Query: 148 VKFLDRRKTNISESICQRCFHQSRTKV 228 VKFLD RKTN ESICQ F K+ Sbjct: 2 VKFLDLRKTNYCESICQDVFINQERKL 28 >SB_26327| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 41.9 bits (94), Expect = 2e-04 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 1/36 (2%) Frame = +2 Query: 170 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVLTVN 274 R+T+ ++ + FINQERKLE RRR DT LVLT+N Sbjct: 8 RKTNYCESICQECFINQERKLEDRRRSDTVLVLTIN 43 Score = 29.9 bits (64), Expect = 0.84 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +1 Query: 151 KFLDRRKTNISESICQRCFHQSRTKV 228 + L RKTN ESICQ CF K+ Sbjct: 3 EILGFRKTNYCESICQECFINQERKL 28 >SB_1546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 41.9 bits (94), Expect = 2e-04 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 1/36 (2%) Frame = +2 Query: 170 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVLTVN 274 R+T+ ++ + FINQERKLE RRR DT LVLT+N Sbjct: 8 RKTNYCESICQECFINQERKLEDRRRSDTVLVLTIN 43 Score = 38.7 bits (86), Expect = 0.002 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +1 Query: 148 VKFLDRRKTNISESICQRCFHQSRTKV 228 VKFLD RKTN ESICQ CF K+ Sbjct: 2 VKFLDLRKTNYCESICQECFINQERKL 28 >SB_13730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 41.9 bits (94), Expect = 2e-04 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 1/36 (2%) Frame = +2 Query: 170 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVLTVN 274 R+T+ ++ + FINQERKLE RRR DT LVLT+N Sbjct: 8 RKTNYCESICQECFINQERKLEDRRRSDTVLVLTIN 43 Score = 38.7 bits (86), Expect = 0.002 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = +1 Query: 148 VKFLDRRKTNISESICQRCFHQSRTKV 228 VKFLD RKTN ESICQ CF K+ Sbjct: 2 VKFLDLRKTNYCESICQECFINQERKL 28 >SB_35396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 53 Score = 28.3 bits (60), Expect = 2.6 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +3 Query: 87 QNSEVMINRDNWGHSY-CDVRGEILGSSQDEHQRKHLP 197 Q EV +++ GH Y C GE++ S++D H+ +P Sbjct: 7 QCKEVESSKEILGHPYVCAFAGEVIQSTEDVHKPSWIP 44 >SB_35857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2680 Score = 27.9 bits (59), Expect = 3.4 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -1 Query: 369 CNHTPPGVQNLWFPGSCPPSHCSNVGGSLDD 277 C+ PG + PGSC P +C N+ GSL D Sbjct: 854 CDRCMPG--SYGGPGSCKPCNC-NMAGSLSD 881 >SB_19517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1696 Score = 27.9 bits (59), Expect = 3.4 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -1 Query: 336 WFPGSCPPSHCSNVGGSLDDIFTVRTRAVS 247 W+PG CPP C+ +L + TV + +S Sbjct: 80 WYPGYCPPHKCAG-RNTLQECCTVYSPEIS 108 >SB_15898| Best HMM Match : Fork_head (HMM E-Value=0) Length = 460 Score = 27.9 bits (59), Expect = 3.4 Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = -1 Query: 360 TPPGV-QNLWFPGSCPPSHCSNVGG 289 +P GV +N W PGS S+C++ GG Sbjct: 174 SPYGVDENSWSPGSSQSSNCTSPGG 198 >SB_23259| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1449 Score = 27.5 bits (58), Expect = 4.5 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -3 Query: 166 DDPRISPLTSQYEC 125 DDPR+SP + QY C Sbjct: 241 DDPRVSPTSQQYAC 254 >SB_42296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 27.1 bits (57), Expect = 5.9 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +2 Query: 251 TALVLTVNMSSSDPPTLLQWLGGQLPGNQRFWTP 352 TA + N S PPT+ L G G +++W+P Sbjct: 191 TAKWVDDNSSDIIPPTVTSLLKGSSMGTRKYWSP 224 >SB_42285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1153 Score = 27.1 bits (57), Expect = 5.9 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -1 Query: 402 CPSVNSFKFQLCNHTPPGVQNL 337 CP + S F CN T GV+ L Sbjct: 199 CPGLTSINFSYCNITDKGVEEL 220 >SB_55801| Best HMM Match : EPTP (HMM E-Value=0.24) Length = 426 Score = 26.6 bits (56), Expect = 7.8 Identities = 16/64 (25%), Positives = 31/64 (48%) Frame = -2 Query: 296 SADR*MTYLRLELGRYLIAFEPLTFVLD**KHLWQMLSLMFVLRRSKNFTSNVAIRMPPV 117 + DR M + +L +G Y+ + E + H+ L+F+ +R +NF +N+ P+ Sbjct: 279 TGDRFMMHQQLPIGGYISSAETM--------HMGNDTFLLFLAKRQRNFGANLFNTKSPI 330 Query: 116 IPIN 105 N Sbjct: 331 YKFN 334 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,393,681 Number of Sequences: 59808 Number of extensions: 236893 Number of successful extensions: 625 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 599 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 625 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 740151420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -