BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30986 (408 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68117-2|CAA92178.1| 333|Caenorhabditis elegans Hypothetical pr... 31 0.42 AC006675-6|AAK84556.2| 433|Caenorhabditis elegans Nuclear hormo... 27 5.2 >Z68117-2|CAA92178.1| 333|Caenorhabditis elegans Hypothetical protein F45E6.4 protein. Length = 333 Score = 30.7 bits (66), Expect = 0.42 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -1 Query: 402 CPSVNSFKFQLCNHTPPGVQNLWFPGSCPPSHCSN 298 CP ++F F C G++ +FPG+CP CS+ Sbjct: 203 CPCQHAFAFPAC-----GMETGFFPGTCPEMTCSS 232 >AC006675-6|AAK84556.2| 433|Caenorhabditis elegans Nuclear hormone receptor familyprotein 98 protein. Length = 433 Score = 27.1 bits (57), Expect = 5.2 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 157 LDRRKTNISESICQRCFHQSRTKVRGS 237 L+ +S ICQ CFHQ K++G+ Sbjct: 331 LEPTHEELSYMICQLCFHQVGKKLQGN 357 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,325,381 Number of Sequences: 27780 Number of extensions: 178357 Number of successful extensions: 514 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 500 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 514 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 651753158 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -