BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30986 (408 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 23 1.8 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 23 1.8 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 23 1.8 DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 22 2.3 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 2.3 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 21 5.4 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 20 9.4 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 20 9.4 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 20 9.4 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 1.8 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 5/26 (19%) Frame = -2 Query: 140 VAIRMPPVIPINH-----YLGVLKTN 78 +A+ PPV+P NH YL V++ N Sbjct: 353 LAVPAPPVLPENHLKNAKYLDVIERN 378 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 1.8 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 5/26 (19%) Frame = -2 Query: 140 VAIRMPPVIPINH-----YLGVLKTN 78 +A+ PPV+P NH YL V++ N Sbjct: 353 LAVPAPPVLPENHLKNAKYLDVIERN 378 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 1.8 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 5/26 (19%) Frame = -2 Query: 140 VAIRMPPVIPINH-----YLGVLKTN 78 +A+ PPV+P NH YL V++ N Sbjct: 353 LAVPAPPVLPENHLKNAKYLDVIERN 378 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 22.2 bits (45), Expect = 2.3 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +2 Query: 152 NSWIVARRTSAKAFAKGVFINQERKLEVRRRLDTALVLTVN 274 N +VAR A F V IN+ + R+ L+ T+N Sbjct: 351 NQAVVARHDEAMIFPADVKINRGLXWIISDRMPVFLLXTLN 391 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.2 bits (45), Expect = 2.3 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 163 RRKTNISESICQRCFHQ 213 RR+ N++E++C F Q Sbjct: 966 RRRLNVNETVCSDYFSQ 982 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 21.0 bits (42), Expect = 5.4 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = -2 Query: 122 PVIPINHYLGVLKTNKIEPRSYSIIPCTKYSSSIFSPL 9 P +N KT I R++ ++ YS+S F+P+ Sbjct: 287 PFFCVNIVTSYCKTC-ISGRAFQVLTWLGYSNSAFNPI 323 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 20.2 bits (40), Expect = 9.4 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +3 Query: 126 HSYCDVRGEILGSSQDEHQRKHLP 197 H YC VR ++ R++LP Sbjct: 428 HCYCPVRFGRKADPNGDYIRRYLP 451 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 20.2 bits (40), Expect = 9.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 379 VSALQPYSPRSPKSLVS 329 V AL+P+ P KSL S Sbjct: 447 VRALKPFIPAVTKSLAS 463 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 20.2 bits (40), Expect = 9.4 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -1 Query: 72 RTEIIFYYSMHEIFKQHF*PA 10 ++E I Y MH+I K+ PA Sbjct: 257 KSEPIDAYEMHQISKKKLSPA 277 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,584 Number of Sequences: 438 Number of extensions: 2390 Number of successful extensions: 9 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10256061 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -