BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30986 (408 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g10890.1 68417.m01772 expressed protein 29 1.6 At1g19150.1 68414.m02384 chlorophyll A-B binding protein, putati... 28 2.8 At3g49060.1 68416.m05360 protein kinase family protein / U-box d... 27 3.7 At3g17465.1 68416.m02230 ribosomal protein L3 family protein 27 3.7 At5g38320.1 68418.m04625 expressed protein ; expression support... 27 4.8 At2g11620.1 68415.m01249 hypothetical protein 27 4.8 At3g45800.1 68416.m04957 hypothetical protein 27 6.4 At3g51120.1 68416.m05598 zinc finger (CCCH-type) family protein ... 26 8.5 >At4g10890.1 68417.m01772 expressed protein Length = 527 Score = 28.7 bits (61), Expect = 1.6 Identities = 13/40 (32%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +1 Query: 166 RKTNISESICQRCFHQS-RTKVRGSKAIRYRPSSNRKYVI 282 ++T I +C RC+H S R K+R S R S++ ++ Sbjct: 194 KQTKICSRVCSRCYHYSMRQKLRHSLHTRILKSNSENAIL 233 >At1g19150.1 68414.m02384 chlorophyll A-B binding protein, putative / LHCI type II, putative very strong similarity to PSI type II chlorophyll a/b-binding protein Lhca2*1 GI:541565 from [Arabidopsis thaliana]; contains Pfam profile: PF00504 chlorophyll A-B binding protein Length = 270 Score = 27.9 bits (59), Expect = 2.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -1 Query: 372 LCNHTPPGVQNLWFPGSCPP 313 +C PP + LWFPGS PP Sbjct: 57 VCEPLPPD-RPLWFPGSSPP 75 >At3g49060.1 68416.m05360 protein kinase family protein / U-box domain-containing protein contains Pfam profile: PF00069 Eukaryotic protein kinase domain Length = 805 Score = 27.5 bits (58), Expect = 3.7 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = -2 Query: 203 HLWQMLSLMFVLRRSKNFTSNVAIRMPPVIPINHYLGVLKTNKIE 69 H+W + + R+ N SN MPP++ ++ K+ K+E Sbjct: 162 HIWFLCKGYLIFTRASNDDSNNRQTMPPLVQLDSDNETRKSEKLE 206 >At3g17465.1 68416.m02230 ribosomal protein L3 family protein Length = 324 Score = 27.5 bits (58), Expect = 3.7 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +2 Query: 221 RKLEVRRRLDTALVLTVNMSSSDPPTLLQWLGGQLPG 331 RK+ R D V V + DP L W+ GQ+PG Sbjct: 234 RKMAGRMGADQRTVKNVWVYKIDPARNLMWVRGQVPG 270 >At5g38320.1 68418.m04625 expressed protein ; expression supported by MPSS Length = 212 Score = 27.1 bits (57), Expect = 4.8 Identities = 14/48 (29%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = -2 Query: 164 RSKNFTSNVAIRMPPVIPINHYLGVLKTNKIEPRSYSI-IPCTKYSSS 24 RSK + P +IPI + VL+ +I + Y + +P Y+S+ Sbjct: 85 RSKTDKYKTGLPRPEIIPIEDFEPVLEIEEIGDQEYEVKLPLLPYNST 132 >At2g11620.1 68415.m01249 hypothetical protein Length = 491 Score = 27.1 bits (57), Expect = 4.8 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 357 PPGVQNLWFPGSCPPSHCSNVGGS 286 PPG + WFP S P C+N G S Sbjct: 105 PPGANDHWFPYSDPA--CTNSGAS 126 >At3g45800.1 68416.m04957 hypothetical protein Length = 563 Score = 26.6 bits (56), Expect = 6.4 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -1 Query: 357 PPGVQNLWFPGSCPPSHCSNVG 292 PPG + WFP S P C+N+G Sbjct: 295 PPGANDHWFPYSDPA--CTNLG 314 >At3g51120.1 68416.m05598 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 1230 Score = 26.2 bits (55), Expect = 8.5 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = +2 Query: 239 RRLDTALVLTVNMSSSDPPTLLQWLGGQLPGNQRFWTPG 355 R LD A+ T +SD PTL L G+ P N PG Sbjct: 215 RALDVAVNGTKRRRTSDSPTLPNKLDGKNPSNILKKAPG 253 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,877,176 Number of Sequences: 28952 Number of extensions: 168419 Number of successful extensions: 458 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 449 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 458 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 605614832 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -