BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30984 (705 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC645.12c |||sequence orphan|Schizosaccharomyces pombe|chr 3||... 28 1.1 SPCC1442.07c |||ubiquitin/metalloprotease fusion protein|Schizos... 27 2.0 SPBC12D12.04c |pck2|sts6, pkc1|protein kinase C |Schizosaccharom... 25 8.0 SPBC11C11.08 |srp1||SR family protein Srp1|Schizosaccharomyces p... 25 8.0 SPAC1687.10 |mcp1||sequence orphan|Schizosaccharomyces pombe|chr... 25 8.0 >SPCC645.12c |||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 198 Score = 28.3 bits (60), Expect = 1.1 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +3 Query: 519 DNDVAPEGYHYLYETENKI 575 DND+ PE Y LYE E+K+ Sbjct: 132 DNDLEPEVYDILYEEESKL 150 >SPCC1442.07c |||ubiquitin/metalloprotease fusion protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 282 Score = 27.5 bits (58), Expect = 2.0 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +3 Query: 138 KPGRYVADPGRYDPSRDN 191 KPG YV+D Y P +DN Sbjct: 235 KPGSYVSDRASYTPQQDN 252 >SPBC12D12.04c |pck2|sts6, pkc1|protein kinase C |Schizosaccharomyces pombe|chr 2|||Manual Length = 1016 Score = 25.4 bits (53), Expect = 8.0 Identities = 17/65 (26%), Positives = 23/65 (35%), Gaps = 3/65 (4%) Frame = +1 Query: 274 DPVLLEVPEEPTSEPRRTSANTLVMLTRDPAXXXXXXXXXXXXXQSHPHTLPARWS---H 444 D +L + P P PR + + +LTRDP +HP W H Sbjct: 893 DAILSDEPLYPIHMPRDSVSILQQLLTRDPKKRLGSGPNDAEDVMTHPFFSNINWDDIYH 952 Query: 445 PHTLP 459 T P Sbjct: 953 KRTQP 957 >SPBC11C11.08 |srp1||SR family protein Srp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 275 Score = 25.4 bits (53), Expect = 8.0 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +2 Query: 611 HRKRRHQGQGILRIRWPRTVSPT 679 H +R +G G+LR+ W + P+ Sbjct: 68 HGRRLERGGGVLRVEWAKQPPPS 90 >SPAC1687.10 |mcp1||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 661 Score = 25.4 bits (53), Expect = 8.0 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +1 Query: 583 KKPARSRTLAPKTKASRSRDSTNTLAPDGVTYRVDYT 693 K ++S TL+P+ K SR L+PD + + T Sbjct: 498 KNHSKSNTLSPRRKGSRHGPREPCLSPDASSSSIPVT 534 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,330,991 Number of Sequences: 5004 Number of extensions: 39810 Number of successful extensions: 142 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 141 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 142 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 327172622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -