BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30983 (766 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 23 2.7 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 23 3.5 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 21 8.2 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 23.0 bits (47), Expect = 2.7 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -1 Query: 301 YQKSLGKFR*IAKRNKFL-GLLEEPGVNTHGCPSRE 197 YQ+ L +R + KF G E+P V T G PSR+ Sbjct: 501 YQQ-LSNYRNVDNSAKFKDGFQEQPNVVTVGNPSRK 535 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 22.6 bits (46), Expect = 3.5 Identities = 11/42 (26%), Positives = 16/42 (38%) Frame = -1 Query: 232 PGVNTHGCPSREYYKIMYAFSKGQIYHQTRKELAYIMRNLIV 107 PG+ HG P + M + G Q R+ + L V Sbjct: 42 PGLGLHGLPVDSLHSSMAGYPAGNQRKQRRERTTFTRAQLDV 83 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 21.4 bits (43), Expect = 8.2 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +2 Query: 671 SRPKDCKQRCHFT 709 +RP DC+Q C T Sbjct: 557 NRPADCQQNCMCT 569 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,468 Number of Sequences: 336 Number of extensions: 3803 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20546262 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -