BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30983 (766 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4078| Best HMM Match : Sua5_yciO_yrdC (HMM E-Value=3e-32) 29 4.1 SB_30225| Best HMM Match : Peptidase_S8 (HMM E-Value=0.0034) 29 5.4 SB_53461| Best HMM Match : Amelogenin (HMM E-Value=0.099) 28 7.2 >SB_4078| Best HMM Match : Sua5_yciO_yrdC (HMM E-Value=3e-32) Length = 303 Score = 29.1 bits (62), Expect = 4.1 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +3 Query: 459 LSPTITLAQQVQAAL*SPITHTLPEECTEEE 551 L PT TLA Q AA+ SPI+ L + +EE Sbjct: 87 LEPTETLATQATAAMNSPISRRLIPDTQQEE 117 >SB_30225| Best HMM Match : Peptidase_S8 (HMM E-Value=0.0034) Length = 605 Score = 28.7 bits (61), Expect = 5.4 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = +1 Query: 391 SHPTGTL-TGSSRTDYPREHKWLI*VQQLHSRSRYKRPY 504 SHP+ + + RTD R+H+ + V+Q H + R KR + Sbjct: 84 SHPSRSRRSAEDRTDQLRQHRHVTWVEQQHEKVREKRGF 122 >SB_53461| Best HMM Match : Amelogenin (HMM E-Value=0.099) Length = 2489 Score = 28.3 bits (60), Expect = 7.2 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = -2 Query: 321 YCSCDAIIKRVWASLDKLPNETSFSGYWKSLV 226 YC C W D+ N +S YWK L+ Sbjct: 2252 YCKCLLWSTEFWGVEDRAVNVSSLKAYWKRLL 2283 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,293,472 Number of Sequences: 59808 Number of extensions: 478890 Number of successful extensions: 912 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 858 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 912 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2072022557 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -