BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30979 (655 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g41990.1 68415.m05194 expressed protein 31 0.51 At3g59570.1 68416.m06647 RabGAP/TBC domain-containing protein si... 31 0.88 At1g69420.2 68414.m07975 zinc finger (DHHC type) family protein ... 29 3.6 At1g69420.1 68414.m07974 zinc finger (DHHC type) family protein ... 29 3.6 At2g36650.1 68415.m04495 expressed protein 28 6.2 At1g04500.1 68414.m00441 zinc finger CONSTANS-related similar to... 28 6.2 At2g33350.1 68415.m04088 hypothetical protein 27 8.2 >At2g41990.1 68415.m05194 expressed protein Length = 297 Score = 31.5 bits (68), Expect = 0.51 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = -3 Query: 236 APLLMHYSRFLTCISRIFSFTTRVNGSLTNSIFLRMTHSLMLFQKIKF 93 +PLL+HYS L + FT NG TN + + H + L+ + F Sbjct: 194 SPLLLHYSNLLLSSGEMNKFTVGRNGE-TNVVTVVQGHQIPLYGGVSF 240 >At3g59570.1 68416.m06647 RabGAP/TBC domain-containing protein similar to GTPase activating protein [Yarrowia lipolytica] GI:2370595; contains Pfam profile PF00566: TBC domain Length = 720 Score = 30.7 bits (66), Expect = 0.88 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -2 Query: 279 SFVLDNKPLGFPLDRPVVDALFKVPNMYFKDIF 181 SFV + P GFP P D +F P++ D+F Sbjct: 213 SFVPPSSPYGFPSPGPFADDIFDFPSLPVTDLF 245 >At1g69420.2 68414.m07975 zinc finger (DHHC type) family protein contains Pfam profile: PF01529: DHHC zinc finger domain Length = 596 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +2 Query: 41 SFYIFFG-YYGCKIHQFIKI*FFGTTLDCV 127 +FY+FF + G KIHQ+I + + + CV Sbjct: 27 AFYVFFAPFVGKKIHQYIAMGIYTPLITCV 56 >At1g69420.1 68414.m07974 zinc finger (DHHC type) family protein contains Pfam profile: PF01529: DHHC zinc finger domain Length = 596 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +2 Query: 41 SFYIFFG-YYGCKIHQFIKI*FFGTTLDCV 127 +FY+FF + G KIHQ+I + + + CV Sbjct: 27 AFYVFFAPFVGKKIHQYIAMGIYTPLITCV 56 >At2g36650.1 68415.m04495 expressed protein Length = 373 Score = 27.9 bits (59), Expect = 6.2 Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 3/83 (3%) Frame = +1 Query: 247 EAKRLIVKNKRFERSQVLAFVVEWIDENKELEWESTFSTSR--QHESFRHVTELFRHIKR 420 E K IVK + + A+V +E +EL +S+ STS E +R + E + +K+ Sbjct: 206 ETKNNIVKELEGKVKDMEAYVDVLQEEKEELFMKSSNSTSEMVSVEDYRRIVEEYEELKK 265 Query: 421 -YFSFVEHLHNFSHWHGVFFKYD 486 Y + V+ + N W +++ Sbjct: 266 DYANGVKEVINL-RWSNACLRHE 287 >At1g04500.1 68414.m00441 zinc finger CONSTANS-related similar to Zinc finger protein constans-like 15 (SP:Q9FHH8) {Arabidopsis thaliana} Length = 386 Score = 27.9 bits (59), Expect = 6.2 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +1 Query: 604 IVFGSQEDFDNSVTGDI 654 I+F SQ+DFDN +T I Sbjct: 85 IIFDSQDDFDNDITASI 101 >At2g33350.1 68415.m04088 hypothetical protein Length = 440 Score = 27.5 bits (58), Expect = 8.2 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +1 Query: 604 IVFGSQEDFDNSVTGDI 654 I+F SQEDF+N +T I Sbjct: 127 IIFDSQEDFENDITASI 143 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,403,004 Number of Sequences: 28952 Number of extensions: 315084 Number of successful extensions: 836 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 823 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 836 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1363910256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -