BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30972 (449 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57834| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_46682| Best HMM Match : Fibrinogen_C (HMM E-Value=0.022) 31 0.33 SB_34070| Best HMM Match : Mucin (HMM E-Value=5.8) 29 1.3 SB_11312| Best HMM Match : Ank (HMM E-Value=2.1e-18) 29 1.8 SB_33861| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_9222| Best HMM Match : 7tm_1 (HMM E-Value=4.1e-06) 28 3.1 SB_3330| Best HMM Match : RBM1CTR (HMM E-Value=0.62) 28 3.1 SB_54983| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_23698| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_3924| Best HMM Match : E-MAP-115 (HMM E-Value=4.2) 27 5.4 SB_57201| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_45123| Best HMM Match : zf-C2H2 (HMM E-Value=0) 27 7.2 SB_23156| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_57888| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 >SB_57834| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 31.9 bits (69), Expect = 0.25 Identities = 18/49 (36%), Positives = 24/49 (48%) Frame = +2 Query: 176 ENKILAEEAGKVENVGTENEGIKVKGFYEYVGPDGVTYRVDYTADENGF 322 EN L + GK + + + I G+YEY GP + RV AD GF Sbjct: 154 ENSTLTQNCGKW-GISSSSVEINRWGYYEYTGPKRMYARVIVWADHLGF 201 >SB_46682| Best HMM Match : Fibrinogen_C (HMM E-Value=0.022) Length = 395 Score = 31.5 bits (68), Expect = 0.33 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = +2 Query: 167 YETENKILAEEAGKVENVGTENEGIKVKGFYEYVGPDGVTYRVDYTADENGF 322 + ++N L + GK + + + I G+YEY GP + RV AD GF Sbjct: 315 FTSKNSTLTQNCGKW-GISSSSVEINRWGYYEYTGPKRMYARVIVWADHLGF 365 >SB_34070| Best HMM Match : Mucin (HMM E-Value=5.8) Length = 541 Score = 29.5 bits (63), Expect = 1.3 Identities = 19/43 (44%), Positives = 24/43 (55%) Frame = +3 Query: 147 PKATTTCTRPRTRFSLKKPARSRTLAPKTKASRSRDSTNTLAP 275 PK T TRP+TR + R +T PKTK S+S+ T T P Sbjct: 270 PK-TRPKTRPKTRPKTRPKTRPKT-RPKTK-SKSKSKTKTATP 309 >SB_11312| Best HMM Match : Ank (HMM E-Value=2.1e-18) Length = 516 Score = 29.1 bits (62), Expect = 1.8 Identities = 16/61 (26%), Positives = 25/61 (40%) Frame = +2 Query: 41 SKVVTPTYVASKVVPPSGAGYDYKYGIIRYDNDVAPEGYHYLYETENKILAEEAGKVENV 220 + ++ P V +K P G DY Y + D +A YH L E +E++ Sbjct: 183 ANIIAPISVVNKF--PPGTVVDYAYNVFYQDRKIAHTPYHALTVGERDCYNARRDMLEHL 240 Query: 221 G 223 G Sbjct: 241 G 241 >SB_33861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1205 Score = 28.7 bits (61), Expect = 2.3 Identities = 21/70 (30%), Positives = 32/70 (45%) Frame = +2 Query: 119 IIRYDNDVAPEGYHYLYETENKILAEEAGKVENVGTENEGIKVKGFYEYVGPDGVTYRVD 298 I+RYD + P Y E++I E K +++ G+ GF+E +G D Sbjct: 491 IVRYDRNKVPSLYQLFKFIESRIEFELRTKHKSIFGYALGVIFAGFFEGIGMFKPKLG-D 549 Query: 299 YTADENGFVA 328 +ENG VA Sbjct: 550 SKLNENGHVA 559 >SB_9222| Best HMM Match : 7tm_1 (HMM E-Value=4.1e-06) Length = 425 Score = 28.3 bits (60), Expect = 3.1 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -2 Query: 67 NVCGCDHLAGNVCGCDWHGNGR 2 N GC+ GN GC++ G+ R Sbjct: 382 NTMGCEFQGGNTMGCEFQGDSR 403 >SB_3330| Best HMM Match : RBM1CTR (HMM E-Value=0.62) Length = 546 Score = 28.3 bits (60), Expect = 3.1 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +3 Query: 159 TTCTRPRTRFSLKKPARSRTLAPKTKASRSRDSTNTLAPTV 281 T T R R+ + P RS L P+ +ASRSRD APT+ Sbjct: 262 TELTERRKRYFVS-PLRSSCLWPRGRASRSRD--GACAPTM 299 >SB_54983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.5 bits (58), Expect = 5.4 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 174 PRTRFSLKKPARSRTLAPKTKASRSRD 254 P+T+ KP +R + KTK SR++D Sbjct: 25 PKTKTKTSKPQAARQASRKTKTSRTQD 51 >SB_23698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 27.5 bits (58), Expect = 5.4 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +3 Query: 162 TCTRPRTRFSLKKPARSRTLAPKTKASRSRDS 257 TC R + SL P+ S + +P A+R RDS Sbjct: 44 TCPHCRAKASLPSPSPSPSPSPSQGATRERDS 75 >SB_3924| Best HMM Match : E-MAP-115 (HMM E-Value=4.2) Length = 344 Score = 27.5 bits (58), Expect = 5.4 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +3 Query: 174 PRTRFSLKKPARSRTLAPKTKASRSRDSTNTLA 272 P+T+ + KPAR R +PK K S+ +D +A Sbjct: 289 PKTKST--KPARPRQASPKAKTSKPQDQDKQVA 319 >SB_57201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 221 Score = 27.1 bits (57), Expect = 7.2 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +3 Query: 216 TLAPKTKASRSRDSTNTL 269 T+APKTK SR+ +TNT+ Sbjct: 11 TMAPKTKCSRATMATNTV 28 >SB_45123| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 336 Score = 27.1 bits (57), Expect = 7.2 Identities = 14/52 (26%), Positives = 27/52 (51%) Frame = +2 Query: 170 ETENKILAEEAGKVENVGTENEGIKVKGFYEYVGPDGVTYRVDYTADENGFV 325 E K + ++GK ++ T+ + ++ K Y +G++Y A ENGF+ Sbjct: 41 EFRGKHQSSKSGKFFDLFTDEKALQRKYTYSADVCEGLSYAAKRFASENGFI 92 >SB_23156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 267 Score = 26.6 bits (56), Expect = 9.5 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +3 Query: 147 PKATTTCTRPRTRFSLKKPARSRTLAPKTKASRS 248 P T+T PR+R + + +RSRT+ P T ++ S Sbjct: 178 PSRTST---PRSRLTPRSRSRSRTITPSTPSTTS 208 >SB_57888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 565 Score = 26.6 bits (56), Expect = 9.5 Identities = 10/25 (40%), Positives = 10/25 (40%) Frame = +3 Query: 6 PFPCQSHPHTLPARWSHPHTLPARW 80 P P HP A W HP A W Sbjct: 402 PRPICGHPSKTHANWCHPTKTQANW 426 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,249,102 Number of Sequences: 59808 Number of extensions: 203295 Number of successful extensions: 737 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 598 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 733 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 896151577 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -