BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30971 (628 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 23 2.4 L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. 23 3.2 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 23.0 bits (47), Expect = 2.4 Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 2/58 (3%) Frame = -1 Query: 628 PKVNSFFFTTFNWLRKLNSAAFFWSLANL--FSYLETFFSVGLTNLPLRSLTWEFRSE 461 PKV + T +W ++ F + +A L F+ + F VG +PL WE +E Sbjct: 299 PKVR--YATALDWFLLMS---FGYCIATLLEFAGVHYFTKVGSGEIPLEEEEWENENE 351 >L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. Length = 382 Score = 22.6 bits (46), Expect = 3.2 Identities = 9/36 (25%), Positives = 18/36 (50%) Frame = +1 Query: 325 VNLRTLTTPTKILLRGFAKTTMNASLVLKMKNSIWN 432 + + + P LL GF ++T + + ++ N WN Sbjct: 13 IGVLLMLAPINALLLGFVQSTPDNNKTVREFNVYWN 48 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,607 Number of Sequences: 438 Number of extensions: 1918 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18704709 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -