BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30970 (839 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY825780-1|AAV70343.1| 147|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825779-1|AAV70342.1| 147|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825778-1|AAV70341.1| 161|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825777-1|AAV70340.1| 161|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825776-1|AAV70339.1| 161|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825775-1|AAV70338.1| 161|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825774-1|AAV70337.1| 160|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825773-1|AAV70336.1| 160|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825772-1|AAV70335.1| 162|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825771-1|AAV70334.1| 162|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825770-1|AAV70333.1| 160|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825769-1|AAV70332.1| 160|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825768-1|AAV70331.1| 160|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825767-1|AAV70330.1| 160|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825766-1|AAV70329.1| 147|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825765-1|AAV70328.1| 147|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825764-1|AAV70327.1| 160|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825763-1|AAV70326.1| 160|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825762-1|AAV70325.1| 146|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825761-1|AAV70324.1| 146|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825760-1|AAV70323.1| 160|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825759-1|AAV70322.1| 160|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825758-1|AAV70321.1| 160|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825757-1|AAV70320.1| 160|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825756-1|AAV70319.1| 160|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825755-1|AAV70318.1| 160|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825754-1|AAV70317.1| 160|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825753-1|AAV70316.1| 160|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825752-1|AAV70315.1| 144|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825751-1|AAV70314.1| 144|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825750-1|AAV70313.1| 130|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825749-1|AAV70312.1| 130|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825748-1|AAV70311.1| 160|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825747-1|AAV70310.1| 160|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825746-1|AAV70309.1| 160|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825745-1|AAV70308.1| 160|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825744-1|AAV70307.1| 160|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825743-1|AAV70306.1| 160|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825742-1|AAV70305.1| 160|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825741-1|AAV70304.1| 160|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825740-1|AAV70303.1| 161|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825739-1|AAV70302.1| 161|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825738-1|AAV70301.1| 160|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825737-1|AAV70300.1| 160|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825736-1|AAV70299.1| 161|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 AY825735-1|AAV70298.1| 161|Anopheles gambiae alanyl-tRNA synthe... 29 0.13 EF034031-1|ABK32002.1| 70|Anopheles gambiae serpin 4A protein. 27 0.71 AJ237705-1|CAB40346.1| 557|Anopheles gambiae putative apyrase p... 25 3.8 AJ237704-1|CAB40345.1| 557|Anopheles gambiae apyrase protein. 25 3.8 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 24 5.0 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 24 6.6 AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F rec... 23 8.7 >AY825780-1|AAV70343.1| 147|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 147 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 32 VILDRTNFYAESGGQIYDQG 51 >AY825779-1|AAV70342.1| 147|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 147 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 32 VILDRTNFYAESGGQIYDQG 51 >AY825778-1|AAV70341.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 46 VILDRTNFYAESGGQIYDQG 65 >AY825777-1|AAV70340.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 46 VILDRTNFYAESGGQIYDQG 65 >AY825776-1|AAV70339.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 46 VILDRTNFYAESGGQIYDQG 65 >AY825775-1|AAV70338.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 46 VILDRTNFYAESGGQIYDQG 65 >AY825774-1|AAV70337.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 46 VILDRTNFYAESGGQIYDQG 65 >AY825773-1|AAV70336.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 46 VILDRTNFYAESGGQIYDQG 65 >AY825772-1|AAV70335.1| 162|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 162 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 46 VILDRTNFYAESGGQIYDQG 65 >AY825771-1|AAV70334.1| 162|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 162 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 46 VILDRTNFYAESGGQIYDQG 65 >AY825770-1|AAV70333.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 46 VILDRTNFYAESGGQIYDQG 65 >AY825769-1|AAV70332.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 46 VILDRTNFYAESGGQIYDQG 65 >AY825768-1|AAV70331.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 46 VILDRTNFYAESGGQIYDQG 65 >AY825767-1|AAV70330.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 46 VILDRTNFYAESGGQIYDQG 65 >AY825766-1|AAV70329.1| 147|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 147 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 33 VILDRTNFYAESGGQIYDQG 52 >AY825765-1|AAV70328.1| 147|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 147 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 33 VILDRTNFYAESGGQIYDQG 52 >AY825764-1|AAV70327.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 46 VILDRTNFYAESGGQIYDQG 65 >AY825763-1|AAV70326.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 46 VILDRTNFYAESGGQIYDQG 65 >AY825762-1|AAV70325.1| 146|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 146 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 32 VILDRTNFYAESGGQIYDQG 51 >AY825761-1|AAV70324.1| 146|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 146 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 32 VILDRTNFYAESGGQIYDQG 51 >AY825760-1|AAV70323.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 46 VILDRTNFYAESGGQIYDQG 65 >AY825759-1|AAV70322.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 46 VILDRTNFYAESGGQIYDQG 65 >AY825758-1|AAV70321.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 46 VILDRTNFYAESGGQIYDQG 65 >AY825757-1|AAV70320.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 46 VILDRTNFYAESGGQIYDQG 65 >AY825756-1|AAV70319.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 46 VILDRTNFYAESGGQIYDQG 65 >AY825755-1|AAV70318.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 46 VILDRTNFYAESGGQIYDQG 65 >AY825754-1|AAV70317.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 46 VILDRTNFYAESGGQIYDQG 65 >AY825753-1|AAV70316.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 46 VILDRTNFYAESGGQIYDQG 65 >AY825752-1|AAV70315.1| 144|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 144 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 46 VILDRTNFYAESGGQIYDQG 65 >AY825751-1|AAV70314.1| 144|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 144 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 46 VILDRTNFYAESGGQIYDQG 65 >AY825750-1|AAV70313.1| 130|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 130 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 16 VILDRTNFYAESGGQIYDQG 35 >AY825749-1|AAV70312.1| 130|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 130 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 16 VILDRTNFYAESGGQIYDQG 35 >AY825748-1|AAV70311.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 46 VILDRTNFYAESGGQIYDQG 65 >AY825747-1|AAV70310.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 46 VILDRTNFYAESGGQIYDQG 65 >AY825746-1|AAV70309.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 46 VILDRTNFYAESGGQIYDQG 65 >AY825745-1|AAV70308.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 46 VILDRTNFYAESGGQIYDQG 65 >AY825744-1|AAV70307.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 46 VILDRTNFYAESGGQIYDQG 65 >AY825743-1|AAV70306.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 46 VILDRTNFYAESGGQIYDQG 65 >AY825742-1|AAV70305.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 46 VILDRTNFYAESGGQIYDQG 65 >AY825741-1|AAV70304.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 46 VILDRTNFYAESGGQIYDQG 65 >AY825740-1|AAV70303.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 46 VILDRTNFYAESGGQIYDQG 65 >AY825739-1|AAV70302.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 46 VILDRTNFYAESGGQIYDQG 65 >AY825738-1|AAV70301.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 46 VILDRTNFYAESGGQIYDQG 65 >AY825737-1|AAV70300.1| 160|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 160 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 46 VILDRTNFYAESGGQIYDQG 65 >AY825736-1|AAV70299.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 46 VILDRTNFYAESGGQIYDQG 65 >AY825735-1|AAV70298.1| 161|Anopheles gambiae alanyl-tRNA synthetase protein. Length = 161 Score = 29.5 bits (63), Expect = 0.13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 689 LVTEDTNFYCEEGGQISDSG 748 ++ + TNFY E GGQI D G Sbjct: 46 VILDRTNFYAESGGQIYDQG 65 >EF034031-1|ABK32002.1| 70|Anopheles gambiae serpin 4A protein. Length = 70 Score = 27.1 bits (57), Expect = 0.71 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = +2 Query: 692 VTEDTNFYCEEGGQISDSGVARIDEHLSF*VDSGFKI 802 VT D N EGG ++ + + RI SF VDS F I Sbjct: 14 VTLDVNEQGTEGGAVTAALIDRIGSGYSFLVDSPFLI 50 >AJ237705-1|CAB40346.1| 557|Anopheles gambiae putative apyrase protein. Length = 557 Score = 24.6 bits (51), Expect = 3.8 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +2 Query: 86 TLSSTYPELVSNKSSAKLIIEHEAQAYAK 172 T+ YP +VSN + K++I +A AY K Sbjct: 272 TILGDYPVVVSNANGRKILIV-QAYAYGK 299 >AJ237704-1|CAB40345.1| 557|Anopheles gambiae apyrase protein. Length = 557 Score = 24.6 bits (51), Expect = 3.8 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +2 Query: 86 TLSSTYPELVSNKSSAKLIIEHEAQAYAK 172 T+ YP +VSN + K++I +A AY K Sbjct: 272 TILGDYPVVVSNANGRKILIV-QAYAYGK 299 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 24.2 bits (50), Expect = 5.0 Identities = 14/55 (25%), Positives = 26/55 (47%) Frame = +2 Query: 20 KICSDVFNNPHLLSNLYDEVAATLSSTYPELVSNKSSAKLIIEHEAQAYAKMRAG 184 K C + + LL + AAT + T+ ++ N ++ + A+A AK +G Sbjct: 279 KACPPLSLHGQLLWREFFYCAATKNPTFDKMAGNPICVQIPWDRNAEALAKWASG 333 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 23.8 bits (49), Expect = 6.6 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = +2 Query: 101 YPELVSNKSSAKLIIEHEAQAYAKMRAGL 187 Y ELVS K S + +++ +AK++A + Sbjct: 364 YDELVSAKESKESTLKNSLDKFAKVQANM 392 >AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F receptor protein. Length = 425 Score = 23.4 bits (48), Expect = 8.7 Identities = 13/50 (26%), Positives = 23/50 (46%) Frame = -3 Query: 258 PGVSTSLRLSTSGYLVTRSFHFFARPALIFA*AWASCSIISFALDLLLTS 109 PG + +R G + R+ + ALIF +W ++ + DL + S Sbjct: 253 PGEAKPVRERERGRRMQRTNYLLISIALIFGVSWLPLNLFNLFADLYVHS 302 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 798,246 Number of Sequences: 2352 Number of extensions: 15438 Number of successful extensions: 89 Number of sequences better than 10.0: 52 Number of HSP's better than 10.0 without gapping: 88 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 88891965 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -