BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30968 (800 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase ... 26 1.2 AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 26 1.6 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 24 6.3 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 24 6.3 AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein p... 24 6.3 M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. 23 8.3 AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylch... 23 8.3 AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. 23 8.3 >AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase protein. Length = 808 Score = 26.2 bits (55), Expect = 1.2 Identities = 16/62 (25%), Positives = 28/62 (45%), Gaps = 3/62 (4%) Frame = +1 Query: 382 IKRVCKDYHERIARLEDEKFDLEYIVKRKDMEISDLN---SQVNDLRGKFVKPTLKKVSK 552 +K+VC YH + +E + E +++ I DL Q D R + + K+V Sbjct: 228 VKKVCAGYHASLYPCPNEYNEREEMLRGVRTRIEDLKMVLGQTQDQRQRVLLNVAKEVPN 287 Query: 553 YE 558 +E Sbjct: 288 WE 289 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 25.8 bits (54), Expect = 1.6 Identities = 14/45 (31%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Frame = +3 Query: 462 KERYGDLRPELPSQRPQRQIRQAHTKEGF-QIRKQIRQAPEEGRR 593 +E+ G+ RP +PS P+ R+A+ + ++R++ RQ ++ RR Sbjct: 1067 EEQCGE-RPSMPSSSPRTSERRANIRARMARLRQRHRQHQQDERR 1110 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.8 bits (49), Expect = 6.3 Identities = 17/71 (23%), Positives = 33/71 (46%) Frame = +1 Query: 343 GKPKNIDDANEDTIKRVCKDYHERIARLEDEKFDLEYIVKRKDMEISDLNSQVNDLRGKF 522 G+ + + A + T K + +R L ++ L R++ S+ NS+ ++ +F Sbjct: 1149 GRYEARNPAYQRTTKDLFSGNQQRTQELVNQNETLSCYTSRRNSTTSNANSEPQEVAPQF 1208 Query: 523 VKPTLKKVSKY 555 VK + SKY Sbjct: 1209 VK-FARDSSKY 1218 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.8 bits (49), Expect = 6.3 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = +1 Query: 541 KVSKYENKFAKLQKKAAEFNFRNQLKVVKKKEFTLEEEDKEKKP 672 +++ E K +L++K AE K KKKE ++ED+++ P Sbjct: 30 RIADEEAKQRELERKRAEGESDFGRKK-KKKEIRYDDEDEDEGP 72 >AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein protein. Length = 468 Score = 23.8 bits (49), Expect = 6.3 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 4/37 (10%) Frame = +3 Query: 483 RPELPSQRPQRQ----IRQAHTKEGFQIRKQIRQAPE 581 RP+ + RP RQ + K +Q+ KQIR+APE Sbjct: 235 RPQ--TTRPNRQDIIEVTSFTGKMWYQVYKQIREAPE 269 >M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. Length = 613 Score = 23.4 bits (48), Expect = 8.3 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +3 Query: 495 PSQRPQRQIRQAHTKEGFQIRKQIRQAPEEGRRIQ 599 P Q+ QRQ +Q H + Q ++Q +Q ++ ++ Q Sbjct: 217 PQQQEQRQQQQQHQQREQQQQQQQQQQQQQQQQQQ 251 >AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 2 protein. Length = 569 Score = 23.4 bits (48), Expect = 8.3 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -2 Query: 727 LNLFFFYLLISPACPSTSQAFSL 659 L+ F+LLIS PSTS A L Sbjct: 292 LSQTMFFLLISEIIPSTSLALPL 314 >AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. Length = 603 Score = 23.4 bits (48), Expect = 8.3 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = -1 Query: 74 ELEDGPTRWFSQHEPLVPN 18 +LE+ P W+ +H+ L P+ Sbjct: 534 DLENDPLLWWKEHQVLYPS 552 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 613,945 Number of Sequences: 2352 Number of extensions: 9896 Number of successful extensions: 37 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 84408009 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -