BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30968 (800 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 24 1.9 L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. 23 4.4 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 22 5.8 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 23.8 bits (49), Expect = 1.9 Identities = 13/28 (46%), Positives = 16/28 (57%), Gaps = 4/28 (14%) Frame = -2 Query: 730 CLNLFF----FYLLISPACPSTSQAFSL 659 C+N+ F+LLIS PSTS A L Sbjct: 270 CINILLSQTMFFLLISEIIPSTSLALPL 297 >L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. Length = 382 Score = 22.6 bits (46), Expect = 4.4 Identities = 9/36 (25%), Positives = 18/36 (50%) Frame = +2 Query: 344 VNLRTLTTPTKILLRGFAKTTMNASLVLKMKNSIWN 451 + + + P LL GF ++T + + ++ N WN Sbjct: 13 IGVLLMLAPINALLLGFVQSTPDNNKTVREFNVYWN 48 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 22.2 bits (45), Expect = 5.8 Identities = 16/58 (27%), Positives = 26/58 (44%), Gaps = 3/58 (5%) Frame = +3 Query: 495 PSQRPQRQIRQAHTKEGF---QIRKQIRQAPEEGRRIQLP*PIEGREKEGIHLGRGRQ 659 P P++Q +QA +G + +Q + AP+ LP P+ + RGRQ Sbjct: 219 PGMHPRQQ-QQAQQHQGVVTSPLSQQQQAAPQGAASANLPSPLYPWMRSQFERKRGRQ 275 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,357 Number of Sequences: 438 Number of extensions: 2852 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25367793 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -