BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30966 (748 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59542| Best HMM Match : Pyrophosphatase (HMM E-Value=1.9) 29 5.3 SB_37180| Best HMM Match : zf-AN1 (HMM E-Value=3.7) 29 5.3 SB_7928| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_43634| Best HMM Match : Sushi (HMM E-Value=1.2e-16) 29 5.3 SB_36147| Best HMM Match : Keratin_B2 (HMM E-Value=1.7) 28 7.0 SB_57510| Best HMM Match : Keratin_B2 (HMM E-Value=5.4) 28 9.2 SB_36148| Best HMM Match : Laminin_EGF (HMM E-Value=4.7) 28 9.2 >SB_59542| Best HMM Match : Pyrophosphatase (HMM E-Value=1.9) Length = 149 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +2 Query: 122 KVNQQREIQWRKCIAIFTVFTNWSYSDGD 208 KV+ RE+ K AIF +FT++ Y D D Sbjct: 28 KVHDMREVCENKYDAIFNLFTSFGYFDDD 56 >SB_37180| Best HMM Match : zf-AN1 (HMM E-Value=3.7) Length = 519 Score = 28.7 bits (61), Expect = 5.3 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +2 Query: 374 DMFRFSCSCTCLWYHKFEKMEVATIFRIDV 463 D+F +CSC C+ +H F M + ++DV Sbjct: 124 DVFHIACSCRCVPHHVFMSMCPPSRAQVDV 153 >SB_7928| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 28.7 bits (61), Expect = 5.3 Identities = 9/31 (29%), Positives = 19/31 (61%) Frame = +3 Query: 192 VILMVIRIFLGVILWIASIILPNKWAVSHML 284 V+L ++ + + I+W+ S +L KW+ + L Sbjct: 93 VVLCLLAVLISSIVWVVSALLDKKWSTNPSL 123 >SB_43634| Best HMM Match : Sushi (HMM E-Value=1.2e-16) Length = 986 Score = 28.7 bits (61), Expect = 5.3 Identities = 22/76 (28%), Positives = 36/76 (47%) Frame = -1 Query: 667 RCTVARVKARSTVMATGCTLLLIWNGQSVKRNTALPFVGPLSGCINTGFVGTSEKCCFLE 488 R + +R K+RS V+ T L+I +G + +T +PF L C N G ++ C + Sbjct: 514 RPSFSRRKSRSRVIIH--TALVISSGAQCRNSTKIPFNSSLMFCANDG--KDYKQTCRGD 569 Query: 487 NCEAFFIPNVDAKNGG 440 F + D K+ G Sbjct: 570 GGSPFISESYDRKSRG 585 >SB_36147| Best HMM Match : Keratin_B2 (HMM E-Value=1.7) Length = 533 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 374 DMFRFSCSCTCLWYHKFEKMEVATIFRIDV 463 D+F +CSC C+ YH M ++ +DV Sbjct: 278 DVFPIACSCRCVSYHVLMSMCSSSRAHVDV 307 >SB_57510| Best HMM Match : Keratin_B2 (HMM E-Value=5.4) Length = 198 Score = 27.9 bits (59), Expect = 9.2 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +2 Query: 374 DMFRFSCSCTCLWYHKFEKMEVATIFRIDV 463 D+F +CSC C+++H M ++ +DV Sbjct: 164 DVFPIACSCRCVFHHVLMSMCSSSRAHVDV 193 >SB_36148| Best HMM Match : Laminin_EGF (HMM E-Value=4.7) Length = 540 Score = 27.9 bits (59), Expect = 9.2 Identities = 18/55 (32%), Positives = 24/55 (43%) Frame = +2 Query: 269 SQSHVNYFGLLDFWCLCEAQRTKRPKM*CVGC*LCDMFRFSCSCTCLWYHKFEKM 433 S+SHV+ F + F C C + M D+F +CSC C YH M Sbjct: 464 SRSHVDVFPIA-FSCRCVSHHVLM-SMCFPSRAHVDVFLIACSCRCFPYHVLMSM 516 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,491,023 Number of Sequences: 59808 Number of extensions: 560749 Number of successful extensions: 1409 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1220 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1400 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2022185256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -