BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30958 (796 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g33360.1 68417.m04743 terpene cyclase/mutase-related low simi... 28 6.2 At4g26450.1 68417.m03805 expressed protein 28 6.2 At1g11680.1 68414.m01341 obtusifoliol 14-demethylase (CYP51) ide... 28 6.2 >At4g33360.1 68417.m04743 terpene cyclase/mutase-related low similarity to squalene-hopene cyclase from Zymomonas mobilis [SP|P33990] Length = 344 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +3 Query: 594 KVENVGTENEGIKVKGFYEYVGPRRCHL 677 K+ N TEN I V G Y+G R CH+ Sbjct: 4 KMPNTETENMKILVTGSTGYLGARLCHV 31 >At4g26450.1 68417.m03805 expressed protein Length = 1248 Score = 28.3 bits (60), Expect = 6.2 Identities = 11/41 (26%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = +3 Query: 558 ETENKI--LAEKAGKVENVGTENEGIKVKGFYEYVGPRRCH 674 +TEN+ + +GK ++ G EN+ ++ +Y+ +CH Sbjct: 368 QTENRCETRGQSSGKADSTGDENDQVEDFALVQYIENSKCH 408 >At1g11680.1 68414.m01341 obtusifoliol 14-demethylase (CYP51) identical to obtusifoliol 14-demethylase (GI:14624983) [Arabidopsis thaliana] Length = 488 Score = 28.3 bits (60), Expect = 6.2 Identities = 15/57 (26%), Positives = 24/57 (42%) Frame = +3 Query: 60 ALAAETGKYTPFQYNRVYSTVSPFVYKPGRYVADPGRYDPSRDNSGRYIPDNSGAYN 230 ++ A GK + +T F + DP YDP R + GR +GA++ Sbjct: 366 SVTARDGKTYDIPKGHIVATSPAFANRLPHIFKDPDTYDPERFSPGREEDKAAGAFS 422 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,728,033 Number of Sequences: 28952 Number of extensions: 249171 Number of successful extensions: 783 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 752 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 783 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1794809600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -