BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30953 (553 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC947.07 |||ribosome biogenesis protein Rrp14-C|Schizosaccharo... 27 1.4 SPBC25B2.02c |mam1|SPBC2G5.09c|M-factor transporter Mam1 |Schizo... 27 2.4 SPAC1039.09 |isp5||amino acid permease Isp5|Schizosaccharomyces ... 26 3.2 SPBPB2B2.01 |||amino acid permease, unknown 12|Schizosaccharomyc... 25 5.6 SPBPB8B6.02c |||urea transporter |Schizosaccharomyces pombe|chr ... 25 5.6 SPAC6F6.12 |||autophagy associated protein Atg24|Schizosaccharom... 25 7.4 SPBC28E12.06c |lvs1|SPBC3H7.16|beige protein homolog|Schizosacch... 25 7.4 SPBP8B7.30c |thi5||transcription factor Thi5|Schizosaccharomyces... 25 9.8 SPBC25D12.05 |trm1||N2,N2-dimethylguanosine tRNA methyltransfera... 25 9.8 >SPBC947.07 |||ribosome biogenesis protein Rrp14-C|Schizosaccharomyces pombe|chr 2|||Manual Length = 233 Score = 27.5 bits (58), Expect = 1.4 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = +1 Query: 445 EEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKK 552 EEKR+++EE++K + +LQA + K N + KK Sbjct: 138 EEKRRKIEESDKWHRVLLQA--EGKKLKDNEQLLKK 171 >SPBC25B2.02c |mam1|SPBC2G5.09c|M-factor transporter Mam1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1336 Score = 26.6 bits (56), Expect = 2.4 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = -2 Query: 291 PLFAPFVDVFLQLFIQVRPLLVLTLDEFWISLTLLFRSG 175 P+FA + L LF+Q+ P + + FW S+ L+ +G Sbjct: 796 PIFAYVISKCLNLFMQIDPSIGVA---FWSSMVLVVAAG 831 >SPAC1039.09 |isp5||amino acid permease Isp5|Schizosaccharomyces pombe|chr 1|||Manual Length = 580 Score = 26.2 bits (55), Expect = 3.2 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -3 Query: 62 SLGTGSWTGSTATLECGAAA 3 ++GTG W GS TL G AA Sbjct: 96 AIGTGVWVGSKNTLREGGAA 115 >SPBPB2B2.01 |||amino acid permease, unknown 12|Schizosaccharomyces pombe|chr 2|||Manual Length = 585 Score = 25.4 bits (53), Expect = 5.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -3 Query: 62 SLGTGSWTGSTATLECGAAA 3 ++GTG W GS+ +L G AA Sbjct: 96 AIGTGVWVGSSKSLYRGGAA 115 >SPBPB8B6.02c |||urea transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 673 Score = 25.4 bits (53), Expect = 5.6 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -1 Query: 109 CWLFIECRTGRSRSLSHSALVLGPAAQRRWNV 14 CW I G S L+ AL+L PA+ NV Sbjct: 292 CWWIIPMALGSSAGLACRALLLNPASVTYPNV 323 >SPAC6F6.12 |||autophagy associated protein Atg24|Schizosaccharomyces pombe|chr 1|||Manual Length = 401 Score = 25.0 bits (52), Expect = 7.4 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +1 Query: 208 EFIKRQDQKRSDLDEQLKEY 267 E +KR+DQK+ D+ E L+EY Sbjct: 272 ELLKRRDQKQQDV-EALQEY 290 >SPBC28E12.06c |lvs1|SPBC3H7.16|beige protein homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 2609 Score = 25.0 bits (52), Expect = 7.4 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = -2 Query: 102 CLLSVARVEVGHSVTRHWFLDRQH 31 C L + + +++ R W L R+H Sbjct: 80 CCLQILGIATSYTILRSWLLSRKH 103 >SPBP8B7.30c |thi5||transcription factor Thi5|Schizosaccharomyces pombe|chr 2|||Manual Length = 857 Score = 24.6 bits (51), Expect = 9.8 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 263 NTSTNGANSGPRRRMSSNALKRSRPSARFLV 355 N A P SSN+ K S PS FLV Sbjct: 793 NIPLGHALGNPESNNSSNSFKPSHPSQSFLV 823 >SPBC25D12.05 |trm1||N2,N2-dimethylguanosine tRNA methyltransferase|Schizosaccharomyces pombe|chr 2|||Manual Length = 548 Score = 24.6 bits (51), Expect = 9.8 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = -2 Query: 291 PLFAPFVDVFLQLFIQVRPLLVLTLDEFWISLTLLFRSGC 172 PL + +D + ++F+Q++ VL + SL + SGC Sbjct: 281 PLLSLSIDFYFRVFVQIKAKPVLVKNLQSQSLLIYHCSGC 320 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,536,148 Number of Sequences: 5004 Number of extensions: 20712 Number of successful extensions: 92 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 82 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 92 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 229961028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -