BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30953 (553 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.067 SB_23388| Best HMM Match : ParBc (HMM E-Value=0.3) 30 1.1 SB_46755| Best HMM Match : zf-C2H2 (HMM E-Value=1.09301e-43) 29 2.5 SB_15709| Best HMM Match : CAP_GLY (HMM E-Value=0) 29 3.3 SB_2413| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.4 SB_22747| Best HMM Match : 7tm_1 (HMM E-Value=3.1e-06) 28 5.8 >SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 655 Score = 34.3 bits (75), Expect = 0.067 Identities = 15/25 (60%), Positives = 21/25 (84%) Frame = +1 Query: 442 IEEKRQRLEEAEKKRQAMLQAMKDA 516 +EE+R+RLE EK+RQA QAM++A Sbjct: 319 LEEERKRLENLEKERQAAQQAMQEA 343 >SB_23388| Best HMM Match : ParBc (HMM E-Value=0.3) Length = 1168 Score = 30.3 bits (65), Expect = 1.1 Identities = 12/34 (35%), Positives = 25/34 (73%) Frame = +1 Query: 439 DIEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFT 540 ++EEK++RL+ E+ + ++ +A K+ASK+ + T Sbjct: 427 EVEEKKRRLQRYERLQSSLNEAYKEASKSSVDGT 460 >SB_46755| Best HMM Match : zf-C2H2 (HMM E-Value=1.09301e-43) Length = 1806 Score = 29.1 bits (62), Expect = 2.5 Identities = 14/27 (51%), Positives = 21/27 (77%) Frame = +1 Query: 445 EEKRQRLEEAEKKRQAMLQAMKDASKT 525 EE+RQ+ EEA K+R+ L A K++SK+ Sbjct: 1344 EERRQKREEARKRREEKL-AKKESSKS 1369 >SB_15709| Best HMM Match : CAP_GLY (HMM E-Value=0) Length = 729 Score = 28.7 bits (61), Expect = 3.3 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +1 Query: 439 DIEEKRQRLEEAEKKRQAMLQAMKD 513 D+EEK + LEEA+ + +A+ MKD Sbjct: 522 DLEEKAKELEEAKSENEAISGKMKD 546 >SB_2413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 493 Score = 28.3 bits (60), Expect = 4.4 Identities = 12/40 (30%), Positives = 25/40 (62%) Frame = +1 Query: 175 PAPKQEGEGDPEFIKRQDQKRSDLDEQLKEYINEWRKQRA 294 PA ++EGEG+P+ +R+ Q + ++Q K + +K ++ Sbjct: 56 PANEEEGEGEPKPKRRKAQPSAPKEKQTKSRKRDKKKDKS 95 >SB_22747| Best HMM Match : 7tm_1 (HMM E-Value=3.1e-06) Length = 337 Score = 27.9 bits (59), Expect = 5.8 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -1 Query: 376 RGAFLLRHEKPCAWPASL*GV 314 RGA L R+E PC W A L G+ Sbjct: 69 RGAALQRNEPPCMWIAILNGI 89 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,256,056 Number of Sequences: 59808 Number of extensions: 179771 Number of successful extensions: 629 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 595 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 627 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1276425465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -