BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30945 (777 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35109| Best HMM Match : DUF1174 (HMM E-Value=6) 29 4.2 SB_14894| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 >SB_35109| Best HMM Match : DUF1174 (HMM E-Value=6) Length = 369 Score = 29.1 bits (62), Expect = 4.2 Identities = 16/50 (32%), Positives = 25/50 (50%) Frame = -1 Query: 300 FILNNGYNNIYD*ITNVFGFTSVM*Y*FCKCNFMNYVKNYLHTTTSMRSK 151 FI+ GY IT +G T+ + Y C NFMN ++ T ++ S+ Sbjct: 312 FIITQGYGGTTFIITQGYGGTTGLPYRRCFANFMNCIQKRKTVTVTIFSQ 361 >SB_14894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1052 Score = 27.9 bits (59), Expect = 9.7 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = -3 Query: 166 VNEIEIWACRTNTTKSRRPLDISSVLTFR 80 + + E+W CR + + SRR L + ++ +R Sbjct: 72 IGDFELWRCRLSGSSSRRRLQVMAMSGYR 100 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,815,245 Number of Sequences: 59808 Number of extensions: 378042 Number of successful extensions: 524 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 470 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 524 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2119930593 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -