BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30942 (563 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 26 0.26 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 26 0.26 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 25 0.59 DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory pro... 22 4.2 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 25.8 bits (54), Expect = 0.26 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 1/66 (1%) Frame = +1 Query: 202 KIQTIENE-LDQTQESLMQVNGKLEEKEKALQNAESEVAALNRRIPTAGGGPREVRGASR 378 K ENE L + QESL +N K+E EK +Q + A++ G V+ Sbjct: 1093 KADNKENEQLRKIQESLRDLNRKIESLEK-MQYPDLRSPAVSNVTTFMEGSKATVKNNVE 1151 Query: 379 DRHRQA 396 D + +A Sbjct: 1152 DNYMEA 1157 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 25.8 bits (54), Expect = 0.26 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 1/66 (1%) Frame = +1 Query: 202 KIQTIENE-LDQTQESLMQVNGKLEEKEKALQNAESEVAALNRRIPTAGGGPREVRGASR 378 K ENE L + QESL +N K+E EK +Q + A++ G V+ Sbjct: 1093 KADNKENEQLRKIQESLRDLNRKIESLEK-MQYPDLRSPAVSNVTTFMEGSKATVKNNVE 1151 Query: 379 DRHRQA 396 D + +A Sbjct: 1152 DNYMEA 1157 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 24.6 bits (51), Expect = 0.59 Identities = 20/67 (29%), Positives = 29/67 (43%) Frame = +1 Query: 76 KMQAMKLEKDNALDRAAMCEQQAKDANLRAEKAEEEARQLQKKIQTIENELDQTQESLMQ 255 KM K +KD D+ A+ + + + EKA+ + + K TIEN L S Sbjct: 70 KMVKQKHKKDIRADKKALQKLRRE-----VEKAKRDLSSVHKTTLTIENLLADYDFSETL 124 Query: 256 VNGKLEE 276 K EE Sbjct: 125 TRAKFEE 131 >DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory protein 15 protein. Length = 146 Score = 21.8 bits (44), Expect = 4.2 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -3 Query: 150 VFGLLLTHGSAVERIV 103 VFG LLT+ S+VE ++ Sbjct: 9 VFGALLTYVSSVEYLI 24 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,998 Number of Sequences: 336 Number of extensions: 1471 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13890653 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -