BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30933 (780 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 34 0.004 AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 26 1.5 AY745209-1|AAU93476.1| 167|Anopheles gambiae cytochrome P450 pr... 24 4.6 AY062196-1|AAL58557.1| 151|Anopheles gambiae cytochrome P450 CY... 24 6.1 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 34.3 bits (75), Expect = 0.004 Identities = 17/31 (54%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +3 Query: 636 EGIKVKGFYEYVGPDGVTYRVDYTAD-ENGF 725 +G V+G Y V PDG VDYTAD NGF Sbjct: 45 DGDVVQGSYSVVDPDGTKRTVDYTADPHNGF 75 >AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CYP9L1 protein protein. Length = 533 Score = 25.8 bits (54), Expect = 1.5 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = +3 Query: 123 VYSTVSPFVYKPGRYVADPGRYDPSRDNSGRYIPDNSGAY 242 V+ ++ Y P R+ DP R+DP R N GAY Sbjct: 427 VFIPIAGLHYDP-RFYPDPDRFDPERFNDENKHKIPLGAY 465 >AY745209-1|AAU93476.1| 167|Anopheles gambiae cytochrome P450 protein. Length = 167 Score = 24.2 bits (50), Expect = 4.6 Identities = 8/15 (53%), Positives = 13/15 (86%) Frame = +3 Query: 162 RYVADPGRYDPSRDN 206 RY ++P R++PSR+N Sbjct: 72 RYWSEPKRFNPSREN 86 >AY062196-1|AAL58557.1| 151|Anopheles gambiae cytochrome P450 CYP4D17 protein. Length = 151 Score = 23.8 bits (49), Expect = 6.1 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 144 FVYKPGRYVADPGRYDPSRDNSGR 215 F+ + RY +P ++DP R N R Sbjct: 105 FLGREARYFPEPEKFDPERFNVER 128 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 681,419 Number of Sequences: 2352 Number of extensions: 13396 Number of successful extensions: 40 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81497388 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -