BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30927 (812 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 23 2.5 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 23 3.4 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 23 4.4 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 22 7.8 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 23.4 bits (48), Expect = 2.5 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 632 DISSYGCIYVIITAIV*VDYVNIMCSRNTTLR 727 D+SSY C+ + + V +V I C T R Sbjct: 690 DLSSYNCVPINVQFSVLYGFVIIECQEPVTNR 721 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 23.0 bits (47), Expect = 3.4 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -3 Query: 735 WPRRNVVFREHIIFT*STHTIAV 667 W RRNV+ ++H+ F T ++ + Sbjct: 183 WMRRNVLNKQHVHFHDYTGSVVI 205 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 22.6 bits (46), Expect = 4.4 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +2 Query: 710 RNTTLRRGHRLDPKHIIDLYNFYSSSNT 793 RN LRR +D ++ YN + SS++ Sbjct: 71 RNILLRRTDSMDSQNSASTYNSFLSSDS 98 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 21.8 bits (44), Expect = 7.8 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -3 Query: 600 RIASFCCPGRER 565 RI CCPGR R Sbjct: 403 RILCACCPGRVR 414 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 207,554 Number of Sequences: 438 Number of extensions: 4277 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25853301 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -