BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30923 (671 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0155 - 32031370-32031707,32033066-32033279 34 0.12 12_02_0847 + 23630937-23631099,23631200-23631396,23631604-236317... 32 0.48 02_05_0232 + 27041793-27042087,27042822-27042943,27043098-270432... 31 0.63 05_04_0158 + 18613265-18615304 30 1.9 02_03_0357 + 18075171-18077240 29 3.4 11_06_0722 - 26678873-26680843 28 7.8 09_06_0200 + 21539963-21541271,21541912-21542013,21542095-215422... 28 7.8 >03_06_0155 - 32031370-32031707,32033066-32033279 Length = 183 Score = 33.9 bits (74), Expect = 0.12 Identities = 18/64 (28%), Positives = 33/64 (51%) Frame = +2 Query: 440 IEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLEEE 619 IEE +QR EEA + +Q + +A K + + + G+ + R K+ E L E+ Sbjct: 98 IEELKQREEEATQAQQQADVKLLEAKKLASQYQKEADKCSSGMDTCEEAREKSSEALVEQ 157 Query: 620 KKIS 631 +K++ Sbjct: 158 RKLT 161 >12_02_0847 + 23630937-23631099,23631200-23631396,23631604-23631738, 23631904-23632077,23632195-23632407,23632507-23632751, 23632890-23632930,23633200-23633238,23633552-23633565 Length = 406 Score = 31.9 bits (69), Expect = 0.48 Identities = 18/62 (29%), Positives = 33/62 (53%) Frame = +2 Query: 437 DIEEKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLEE 616 +I E+R+R + ++ A+L+AMK+ N ++ E N +LE K+QL+E Sbjct: 41 EIAEERERFQLEQRGNDALLEAMKE-ELVAANNELEAAKEEISRKNNELE--SVKKQLQE 97 Query: 617 EK 622 + Sbjct: 98 SE 99 >02_05_0232 + 27041793-27042087,27042822-27042943,27043098-27043219, 27043601-27043705,27043828-27044257,27044356-27044517, 27044565-27045260,27045349-27046128,27046441-27046654, 27047621-27047981,27047993-27048140,27048276-27048419, 27048784-27048888,27049749-27049794,27050089-27050255, 27050338-27050490,27050654-27050950,27051053-27051220, 27051298-27051363,27051451-27051927,27052031-27052768, 27052935-27053120 Length = 1993 Score = 31.5 bits (68), Expect = 0.63 Identities = 18/75 (24%), Positives = 37/75 (49%) Frame = +2 Query: 446 EKRQRLEEAEKKRQAMLQAMKDASKTGPNFTIQKKSENFGLSNAQLERNKTKEQLEEEKK 625 E+ ++ ++ + AMLQ +KD N +Q+K ++ ++E +TK Q +E Sbjct: 1431 EEAKKFQKIKMDLLAMLQRVKDVENLNRNEKMQRKDMEEKIARQRMEIEETKRQRDELYH 1490 Query: 626 ISLSIRIKPLTIEGL 670 ++ + L +E L Sbjct: 1491 ELKDVKEQKLCLERL 1505 >05_04_0158 + 18613265-18615304 Length = 679 Score = 29.9 bits (64), Expect = 1.9 Identities = 24/71 (33%), Positives = 39/71 (54%), Gaps = 9/71 (12%) Frame = +2 Query: 443 EEKRQRLEEAEKKRQAML-----QAMKDASKTGPNFTIQKK----SENFGLSNAQLERNK 595 +EK ++ +E E K Q L +AMK KTG N I+KK +E +A++ ++K Sbjct: 608 QEKVEKNQEKEMKIQEKLGEIFDKAMKSEEKTGQNPGIEKKIQDTAEKKQEHDARVVQDK 667 Query: 596 TKEQLEEEKKI 628 ++ +E KKI Sbjct: 668 VEKIQDEAKKI 678 >02_03_0357 + 18075171-18077240 Length = 689 Score = 29.1 bits (62), Expect = 3.4 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 5/44 (11%) Frame = +2 Query: 536 TIQKKSENFGLSNAQLERNKT-----KEQLEEEKKISLSIRIKP 652 +I++K +NF L+ ++ RN+T QL EE KIS+S + P Sbjct: 594 SIKEKFKNFNLAFEEIYRNQTTWKVPDPQLREELKISISENVIP 637 >11_06_0722 - 26678873-26680843 Length = 656 Score = 27.9 bits (59), Expect = 7.8 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +2 Query: 590 NKTKEQLEEEKKISLSIRIKPLTIEGL 670 NKTK+ +E+K++ LS+ +K IE L Sbjct: 418 NKTKKGRKEDKRVRLSMDVKKTVIETL 444 >09_06_0200 + 21539963-21541271,21541912-21542013,21542095-21542291, 21542396-21542603,21542685-21542922,21543010-21543160, 21543538-21543849 Length = 838 Score = 27.9 bits (59), Expect = 7.8 Identities = 10/31 (32%), Positives = 13/31 (41%) Frame = -1 Query: 662 RWSAA*CGWTGRSSSPLPAAPWSCCAPAGHC 570 RWS+ W P P+ C P G+C Sbjct: 272 RWSSGSSAWVVLQEWPAGCDPYDFCGPNGYC 302 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,975,996 Number of Sequences: 37544 Number of extensions: 198420 Number of successful extensions: 797 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 780 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 795 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1703141568 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -