BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30922 (604 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 24 3.3 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 24 4.4 CR954257-3|CAJ14154.1| 277|Anopheles gambiae predicted protein ... 24 4.4 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 23 5.8 AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 23 5.8 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 24.2 bits (50), Expect = 3.3 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 122 PQRSRPALADGFGTFPP 172 P SR A ADG G+ PP Sbjct: 769 PSPSRSAFADGIGSPPP 785 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 23.8 bits (49), Expect = 4.4 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 Query: 61 HQQVPRQGTRGICSERSQPGAPALAP 138 +++VP +GICS+R P A P Sbjct: 993 YRRVPLMDYQGICSDRDNPYTGAGEP 1018 >CR954257-3|CAJ14154.1| 277|Anopheles gambiae predicted protein protein. Length = 277 Score = 23.8 bits (49), Expect = 4.4 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 510 GPDTRTCTPRTLHLT 554 G DTR CTP+T T Sbjct: 125 GTDTRDCTPKTPEYT 139 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 23.4 bits (48), Expect = 5.8 Identities = 13/54 (24%), Positives = 21/54 (38%) Frame = +3 Query: 393 TLLIFIYIIYYRGVCIESASECVXCTCAREHRRDTPPTSGPDTRTCTPRTLHLT 554 T+ + +I+ R V + CV CT R P P+ R R ++ Sbjct: 1372 TMQLRFWIVGARNVAKRTVFNCVKCTRCRPKLIQQPMADLPEQRVRQARPFSIS 1425 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 23.4 bits (48), Expect = 5.8 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +1 Query: 61 HQQVPRQGTRGICSERSQPGAPALAPRP 144 HQQ R+G G ER + P LA P Sbjct: 1104 HQQDERRGVEGGDIERGESVYPELASSP 1131 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 507,125 Number of Sequences: 2352 Number of extensions: 9485 Number of successful extensions: 26 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58450473 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -