BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30916 (714 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 31 0.027 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 25 2.4 M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. 25 3.1 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 24 4.1 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 31.5 bits (68), Expect = 0.027 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = -3 Query: 589 QGPRQHVVGERRISPRARPQAGE*RHQQHPGGHQDLREQLQR 464 Q +Q GER + P+ R Q + +HQQ Q R+Q QR Sbjct: 286 QQQQQQQQGERYVPPQLRQQRQQQQHQQQQQQQQQQRQQQQR 327 Score = 23.8 bits (49), Expect = 5.4 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -3 Query: 415 QGPARPRRQGLDPQEDDGQARRPRRVHLRQETP 317 Q P + R Q PQ+ Q R+P + L + +P Sbjct: 471 QRPQQQRPQQQRPQQQRSQQRKPAKPELIEVSP 503 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 25.0 bits (52), Expect = 2.4 Identities = 15/55 (27%), Positives = 26/55 (47%) Frame = -1 Query: 576 NTSWESGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQYK 412 NT ASA A++ + V +E S ND+++ D++SG + + K Sbjct: 828 NTITYGTASAPFLAIRTLNQVLEDNKEKYPLAASRINDFYVDDFISGADSENEAK 882 >M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. Length = 613 Score = 24.6 bits (51), Expect = 3.1 Identities = 22/90 (24%), Positives = 38/90 (42%), Gaps = 1/90 (1%) Frame = -3 Query: 589 QGPRQHVVGERRISPRARPQAGE*RHQQHPGGHQDLREQLQRLPPGRLLVRGIPRRTVQG 410 Q +QH E++ R + Q + HQ+ Q R+Q Q+ L + RR Sbjct: 264 QQQQQHQQREQQQQQRVQQQNQQ--HQRQQQQQQQQRQQQQQQEQQELWTTVVRRRQNTQ 321 Query: 409 PARPRRQGLDPQEDDGQARRPR-RVHLRQE 323 + Q Q+ G+ + P+ R L+Q+ Sbjct: 322 QQQQSNQPQQQQQQTGRYQPPQMRQQLQQQ 351 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 24.2 bits (50), Expect = 4.1 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = +2 Query: 467 LKLLSQVLMTSRMLLVTSLSSL 532 LKLL+ V MTS+M+L+T L L Sbjct: 897 LKLLA-VCMTSQMMLITQLMPL 917 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 640,500 Number of Sequences: 2352 Number of extensions: 13565 Number of successful extensions: 26 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 73177125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -