BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30915 (645 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-4|CAD27926.1| 338|Anopheles gambiae putative hox prote... 26 0.89 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 25 1.6 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 25 2.0 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 23 6.3 >AJ439353-4|CAD27926.1| 338|Anopheles gambiae putative hox protein protein. Length = 338 Score = 26.2 bits (55), Expect = 0.89 Identities = 14/67 (20%), Positives = 32/67 (47%) Frame = +1 Query: 106 FRRLSSVSSTPGTPTLY*TPQAIRTV*HGTSISGSARGPARTKPARRPSSR*TWTTNNSR 285 +R+L TP Y + + ++ G++++ +A G + + P PS+ + T + Sbjct: 125 YRKLYRGEKTPERYAPYLAVRPVESLTSGSNVAAAAAGASASTPPTIPSASPSPTRSTDL 184 Query: 286 DQRYSTE 306 Q Y+ + Sbjct: 185 SQTYAID 191 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 25.4 bits (53), Expect = 1.6 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +3 Query: 264 LDDEQFQGSAVQHREVQYYESKEFLEYFSPAIRYLKG 374 +D+ G+ Q+ + +KE+L Y SP+ +L G Sbjct: 957 VDESDDNGAIKQNEFPSWASNKEYLAYNSPSATFLGG 993 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 25.0 bits (52), Expect = 2.0 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +1 Query: 271 TNNSRDQRYSTERSNITSPRSS*NISHQPSAI*KADTPQA 390 T + D+ S R+N T S ++S S +A+TP+A Sbjct: 259 TEDDEDENISVTRTNSTIRSRSSSLSRSRSCSRQAETPRA 298 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -2 Query: 164 GVQYNVGVPGVEETELSLRNGDRFEV 87 G N +PGVEE L N + EV Sbjct: 1296 GFGNNDNLPGVEEVAAELENANESEV 1321 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 683,483 Number of Sequences: 2352 Number of extensions: 14427 Number of successful extensions: 17 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63559560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -