BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30914 (710 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 153 1e-39 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 2.9 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 23 2.9 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 23 3.8 L10430-1|AAA27731.1| 150|Apis mellifera transposase protein. 22 5.0 AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 22 6.6 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 22 6.6 EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate c... 21 8.7 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 21 8.7 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 153 bits (372), Expect = 1e-39 Identities = 70/75 (93%), Positives = 74/75 (98%) Frame = +1 Query: 484 EMATAAASTSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKC 663 EMATAA+S+SLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+CGIHET YNSIMKC Sbjct: 1 EMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKC 60 Query: 664 DVDIRKDLYANTVMS 708 DVDIRKDLYANTV+S Sbjct: 61 DVDIRKDLYANTVLS 75 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.0 bits (47), Expect = 2.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 Query: 88 LRVAPEEHPVLLTEAPLNPKANREKM 165 LR+ P H V+ T +NP + EK+ Sbjct: 1461 LRLGPCWHAVMTTYPRINPDNHNEKL 1486 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 23.0 bits (47), Expect = 2.9 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = -3 Query: 450 LLDVTNDFPLSGGGERVTPLGEDLHEVVGQVATSQVQTEDGVGQS-VTFVDGYGVGDT 280 ++D+T S G+ V +L+ +VG A + E+G G + VT + + DT Sbjct: 18 MVDLTQCLQESSTGQSVEFSPMELNALVGTPAAPNMPAEEGEGMAGVTGEEPFDTLDT 75 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 22.6 bits (46), Expect = 3.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 96 DTQLIVEGVVPDLLHVI 46 + Q +V+ V PD+LH+I Sbjct: 21 NNQTVVDKVPPDMLHLI 37 >L10430-1|AAA27731.1| 150|Apis mellifera transposase protein. Length = 150 Score = 22.2 bits (45), Expect = 5.0 Identities = 10/32 (31%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = -1 Query: 677 RMSTSHFMMELYT--VSWMPHDSIPRKEGWKR 588 R F+ L T W+ +++I RK W R Sbjct: 18 RSENDPFLKRLITGDEKWVVYNNIKRKRSWSR 49 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 21.8 bits (44), Expect = 6.6 Identities = 10/32 (31%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = -1 Query: 677 RMSTSHFMMELYT--VSWMPHDSIPRKEGWKR 588 R F+ L T W+ +++I RK W R Sbjct: 139 RNENDPFLKRLITGDEKWVVYNNIKRKRSWSR 170 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 21.8 bits (44), Expect = 6.6 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = +3 Query: 645 QLHHEVRRRHP*GPVRQHRH 704 Q+HH++ +HP +Q +H Sbjct: 167 QMHHQMHTQHPHMQPQQGQH 186 >EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate carboxykinase protein. Length = 118 Score = 21.4 bits (43), Expect = 8.7 Identities = 10/37 (27%), Positives = 16/37 (43%) Frame = -1 Query: 263 TIPVVRPEAYSESTAWMATYMAGELKVSNMIWVIFSL 153 T+P + E + AWM G L+ N + F + Sbjct: 33 TLPGYKIECVGDDIAWMKFDKEGRLRAINPEYGFFGV 69 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.4 bits (43), Expect = 8.7 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 645 QLHHEVRRRHP*GPVRQHR 701 QL+ +V+ H PV+QHR Sbjct: 266 QLNSDVQPGHGSPPVKQHR 284 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,621 Number of Sequences: 438 Number of extensions: 3224 Number of successful extensions: 18 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21926700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -