BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30913 (590 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE013599-753|AAG22299.1| 79|Drosophila melanogaster CG33199-PA... 38 0.010 >AE013599-753|AAG22299.1| 79|Drosophila melanogaster CG33199-PA, isoform A protein. Length = 79 Score = 37.9 bits (84), Expect = 0.010 Identities = 20/70 (28%), Positives = 40/70 (57%), Gaps = 3/70 (4%) Frame = -1 Query: 590 TSSLGCL---ISFGSDIMKTTQVAQYALRLTYSQQANREKMMTRSALLLATIGLGLSTFS 420 TS+LG ++FG +TQ + + ++ +++TRSA +LA G+ LS+FS Sbjct: 3 TSNLGLYAFRLTFGQAPTLSTQATTHCSHGFTTSSSSPNRVVTRSATMLALFGIALSSFS 62 Query: 419 VRQMILNQSR 390 ++Q++ + + Sbjct: 63 LKQLLAKKQK 72 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,668,024 Number of Sequences: 53049 Number of extensions: 459684 Number of successful extensions: 962 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 944 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 962 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2379510885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -