BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30909 (718 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z99278-6|CAD59170.1| 276|Caenorhabditis elegans Hypothetical pr... 29 4.4 Z70752-2|CAA94757.2| 366|Caenorhabditis elegans Hypothetical pr... 28 7.7 >Z99278-6|CAD59170.1| 276|Caenorhabditis elegans Hypothetical protein Y53C12B.5b protein. Length = 276 Score = 28.7 bits (61), Expect = 4.4 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -1 Query: 214 LSIISFPPLLWDPHIIFLQLDEDSVLCSHY 125 + I+ FP LL PH +FL L +S++ S++ Sbjct: 148 IKIVCFPSLLNFPHNLFLSLVSNSMIFSYF 177 >Z70752-2|CAA94757.2| 366|Caenorhabditis elegans Hypothetical protein F25B3.5 protein. Length = 366 Score = 27.9 bits (59), Expect = 7.7 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +1 Query: 133 SITQNLRRAAEKLYEDPIEEVERRLLIASGL 225 SIT++++ + EK + P +RR+LIAS L Sbjct: 4 SITKSIQSSIEKFHASPTPIKKRRILIASPL 34 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,528,355 Number of Sequences: 27780 Number of extensions: 252549 Number of successful extensions: 576 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 572 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 576 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1676746902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -