BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30907 (751 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g09170.1 68414.m01024 kinesin motor protein-related similar t... 50 2e-06 At2g47500.1 68415.m05929 kinesin motor protein-related 49 3e-06 At5g27000.1 68418.m03221 kinesin motor protein-related non-conse... 47 1e-05 At3g10310.1 68416.m01237 kinesin motor protein-related similar t... 44 1e-04 At1g63640.2 68414.m07198 kinesin motor protein-related C-termina... 44 1e-04 At1g63640.1 68414.m07197 kinesin motor protein-related C-termina... 44 1e-04 At5g41310.1 68418.m05020 kinesin motor protein-related 39 0.003 At5g35700.1 68418.m04269 fimbrin-like protein, putative similar ... 39 0.003 At5g48460.1 68418.m05992 fimbrin-like protein, putative strong s... 35 0.066 At2g04750.1 68415.m00485 fimbrin-like protein, putative similar ... 35 0.066 At3g44730.1 68416.m04814 kinesin motor protein-related similar t... 34 0.12 At4g26700.1 68417.m03848 fimbrin-like protein (FIM1) identical t... 33 0.20 At5g55400.1 68418.m06902 fimbrin-like protein, putative similar ... 33 0.27 At5g04980.1 68418.m00527 endonuclease/exonuclease/phosphatase fa... 31 1.1 At4g35800.1 68417.m05087 DNA-directed RNA polymerase II largest ... 30 1.9 At5g02790.1 68418.m00221 In2-1 protein, putative similar to In2-... 29 3.3 At5g02780.1 68418.m00220 In2-1 protein, putative similar to In2-... 29 3.3 At3g12580.1 68416.m01567 heat shock protein 70, putative / HSP70... 29 4.4 At4g33650.1 68417.m04780 dynamin-like protein 2a (ADL2a) identic... 28 5.8 At3g49210.1 68416.m05378 expressed protein 28 5.8 At5g67270.1 68418.m08480 microtubule-associated EB1 family prote... 28 7.6 At5g14570.1 68418.m01708 transporter, putative similar to trans-... 28 7.6 At5g07640.1 68418.m00875 zinc finger (C3HC4-type RING finger) fa... 28 7.6 At3g08590.2 68416.m00998 2,3-biphosphoglycerate-independent phos... 28 7.6 At3g08590.1 68416.m00997 2,3-biphosphoglycerate-independent phos... 28 7.6 At1g09780.1 68414.m01097 2,3-biphosphoglycerate-independent phos... 28 7.6 >At1g09170.1 68414.m01024 kinesin motor protein-related similar to GB:AAB61066 Length = 1010 Score = 49.6 bits (113), Expect = 2e-06 Identities = 38/128 (29%), Positives = 64/128 (50%), Gaps = 19/128 (14%) Frame = +2 Query: 107 EAQEWIE---GVLGAKFPPGELFED----VLKDGTVLCQLINKLKPGSVPK--------- 238 EA W+ GV+G + P + E+ L+ G +LC ++N++KPG+VPK Sbjct: 59 EAARWVRNTLGVVGGRDLPADPSEEDFRIALRSGILLCNVLNRVKPGAVPKVVEAPNDPL 118 Query: 239 INTTG---GQFKMMENITNFQSAIKAYGVPDIDVFQTVDLWEKKDIAQVVSTLFALGRET 409 +N G F+ EN+ NF ++ G+P F+ D + A++V + AL ++ Sbjct: 119 VNQDGAALSAFQYFENLRNFLVFVEEMGIP---TFEVSDFEKGGKSARIVECVLAL--KS 173 Query: 410 YRHAEWSG 433 YR + SG Sbjct: 174 YREWKQSG 181 >At2g47500.1 68415.m05929 kinesin motor protein-related Length = 974 Score = 49.2 bits (112), Expect = 3e-06 Identities = 39/141 (27%), Positives = 65/141 (46%), Gaps = 19/141 (13%) Frame = +2 Query: 32 QSHNMSLERQVRAKIASKRNPEKEKEAQEWIE---GVLGAKFPPGELFEDVLK----DGT 190 Q H L ++ + EA W+ GV+GAK P E E+ L+ G Sbjct: 24 QQHGNGLRDHDLVSRRAEEAASRRYEAANWLRRMVGVVGAKDLPAEPTEEGLRLGLRSGI 83 Query: 191 VLCQLINKLKPGSVPKI------------NTTGGQFKMMENITNFQSAIKAYGVPDIDVF 334 +LC+++NK++PG+V K+ F+ EN+ NF AI+ G P F Sbjct: 84 ILCKVLNKVQPGAVSKVVESPCDAILVADGAPLSAFQYFENVRNFLVAIQEMGFP---TF 140 Query: 335 QTVDLWEKKDIAQVVSTLFAL 397 + DL + + ++VV+ + A+ Sbjct: 141 EASDLEQGGNASRVVNCVLAI 161 >At5g27000.1 68418.m03221 kinesin motor protein-related non-consensus AT donor splice site at exon 12; non-consensus AC acceptor splice site at exon 13 Length = 987 Score = 47.2 bits (107), Expect = 1e-05 Identities = 37/113 (32%), Positives = 57/113 (50%), Gaps = 16/113 (14%) Frame = +2 Query: 107 EAQEWIEGVLGA---KFPPGELFEDV----LKDGTVLCQLINKLKPGSVPKI-----NTT 250 EA W+ ++G K PGE E+ L+ G VLC ++NK+ PGSV K+ + Sbjct: 49 EAAGWLRDMIGVSNGKDFPGEPSEEEFRLGLRSGIVLCNVLNKVNPGSVSKVVEAPDDVA 108 Query: 251 GG----QFKMMENITNFQSAIKAYGVPDIDVFQTVDLWEKKDIAQVVSTLFAL 397 G F+ ENI NF AI+ G+P F+ D+ + ++V+ + AL Sbjct: 109 DGAALSAFQYFENIRNFLVAIEEMGLPS---FEASDMEKGGKSIRIVNCILAL 158 >At3g10310.1 68416.m01237 kinesin motor protein-related similar to carboxy-terminal kinesin 2 GB:P79955 [Xenopus laevis] Length = 897 Score = 43.6 bits (98), Expect = 1e-04 Identities = 33/126 (26%), Positives = 61/126 (48%), Gaps = 18/126 (14%) Frame = +2 Query: 74 IASKRNPE---KEKEAQEWIEGVLGA----KFPPGELFEDVLKDGTVLCQLINKLKPGSV 232 +AS+R E + +A +W++ V+G P + F L++G +LC INK+ PG+V Sbjct: 10 LASRRAEEAAARRFQAVQWLKSVVGQLGIPNQPSEKEFISCLRNGMILCNAINKIHPGAV 69 Query: 233 PKI----NTTGGQFKM------MENITNFQSAIKAYGVPDIDVFQ-TVDLWEKKDIAQVV 379 K+ + G++++ EN+ NF A++ +P + D E + +VV Sbjct: 70 SKVVENYSYLNGEYQLPPAYQYFENVRNFLVALETLRLPGFEASDLEKDNLESGSVTKVV 129 Query: 380 STLFAL 397 + L Sbjct: 130 DCILGL 135 >At1g63640.2 68414.m07198 kinesin motor protein-related C-terminal region is similar to C-term region of kinesin motor protein GB:AAB51397 (Mus musculus); contains Pfam profile: PF00225 Kinesin motor domain Length = 1065 Score = 43.6 bits (98), Expect = 1e-04 Identities = 35/99 (35%), Positives = 50/99 (50%), Gaps = 5/99 (5%) Frame = +2 Query: 116 EWIEGVLGAKFPPGELFED----VLKDGTVLCQLINKLKPGSVPKINTTGGQFKMME-NI 280 EW+ L P E ED L+DGTVLC L+N+L PGS+ GG F+ I Sbjct: 47 EWLNETLPYLKLPWEASEDELRACLRDGTVLCSLLNQLSPGSM----RMGGSFEPASVKI 102 Query: 281 TNFQSAIKAYGVPDIDVFQTVDLWEKKDIAQVVSTLFAL 397 F +A+ +P F+ D+ E+ D+ V+ +L AL Sbjct: 103 ERFLTAMDEMALPR---FEVSDI-EQGDMVPVLQSLKAL 137 >At1g63640.1 68414.m07197 kinesin motor protein-related C-terminal region is similar to C-term region of kinesin motor protein GB:AAB51397 (Mus musculus); contains Pfam profile: PF00225 Kinesin motor domain Length = 1064 Score = 43.6 bits (98), Expect = 1e-04 Identities = 35/99 (35%), Positives = 50/99 (50%), Gaps = 5/99 (5%) Frame = +2 Query: 116 EWIEGVLGAKFPPGELFED----VLKDGTVLCQLINKLKPGSVPKINTTGGQFKMME-NI 280 EW+ L P E ED L+DGTVLC L+N+L PGS+ GG F+ I Sbjct: 47 EWLNETLPYLKLPWEASEDELRACLRDGTVLCSLLNQLSPGSM----RMGGSFEPASVKI 102 Query: 281 TNFQSAIKAYGVPDIDVFQTVDLWEKKDIAQVVSTLFAL 397 F +A+ +P F+ D+ E+ D+ V+ +L AL Sbjct: 103 ERFLTAMDEMALPR---FEVSDI-EQGDMVPVLQSLKAL 137 >At5g41310.1 68418.m05020 kinesin motor protein-related Length = 961 Score = 39.1 bits (87), Expect = 0.003 Identities = 28/82 (34%), Positives = 40/82 (48%), Gaps = 5/82 (6%) Frame = +2 Query: 89 NPEKEKEAQEWIEGVLGAKFPPGELFEDVLK----DGTVLCQLINKLKPGSVPKINTTGG 256 N + + EW+ L P E E+ L+ DGTVLC L+N+L PGS+ GG Sbjct: 39 NKQGHQSLVEWLNETLPYLNLPWEASEEELRACLVDGTVLCNLLNQLSPGSM----RMGG 94 Query: 257 QFKM-MENITNFQSAIKAYGVP 319 F+ NI F +A+ +P Sbjct: 95 SFEPGCVNIERFLAAMDEMTLP 116 >At5g35700.1 68418.m04269 fimbrin-like protein, putative similar to fimbrin-like protein (ATFIM1) [Arabidopsis thaliana] GI:2905893, fimbrin [Schizosaccharomyces pombe] GI:3057144; contains Pfam profile PF00307: Calponin homology (CH) domain Length = 687 Score = 39.1 bits (87), Expect = 0.003 Identities = 23/65 (35%), Positives = 38/65 (58%), Gaps = 4/65 (6%) Frame = +2 Query: 149 PPGELFEDVLKDGTVLCQLINKLKPGSVPK--INT--TGGQFKMMENITNFQSAIKAYGV 316 P F D++KDG +LC+LIN PG++ + INT T ++ EN+T ++ KA G Sbjct: 150 PATNAFFDLVKDGVLLCKLINVAVPGTIDERAINTKKTLNPWERNENLTLGLNSAKAIGC 209 Query: 317 PDIDV 331 +++ Sbjct: 210 TVVNI 214 >At5g48460.1 68418.m05992 fimbrin-like protein, putative strong similarity to fimbrin-like protein AtFim2 [Arabidopsis thaliana] GI:2737926; contains Pfam profile PF00307: Calponin homology (CH) domain Length = 654 Score = 34.7 bits (76), Expect = 0.066 Identities = 23/62 (37%), Positives = 36/62 (58%), Gaps = 4/62 (6%) Frame = +2 Query: 158 ELFEDVLKDGTVLCQLINKLKPGSVPK--INTTG--GQFKMMENITNFQSAIKAYGVPDI 325 +LFE V KDG +LC+LIN PG++ + INT ++ EN T ++ KA G + Sbjct: 156 DLFE-VAKDGVLLCKLINVAVPGTIDERAINTKSMLNPWERNENHTLCLNSAKAIGCTVV 214 Query: 326 DV 331 ++ Sbjct: 215 NI 216 Score = 31.1 bits (67), Expect = 0.82 Identities = 17/45 (37%), Positives = 27/45 (60%) Frame = +2 Query: 98 KEKEAQEWIEGVLGAKFPPGELFEDVLKDGTVLCQLINKLKPGSV 232 +EK + WI G+ + +FED L+DG +L Q ++K+ PG V Sbjct: 396 EEKAFRFWINSFDGSVYI-NNVFED-LRDGWILLQTLDKVSPGIV 438 >At2g04750.1 68415.m00485 fimbrin-like protein, putative similar to fimbrin-like protein (ATFIM1) [Arabidopsis thaliana] GI:2905893; contains Pfam profile PF00307: Calponin homology (CH) domain Length = 652 Score = 34.7 bits (76), Expect = 0.066 Identities = 29/108 (26%), Positives = 52/108 (48%), Gaps = 4/108 (3%) Frame = +2 Query: 20 KALTQSHNMSLERQVRAKIASKRNPEKEKEAQEWIEGVLGAKFPPGELFEDVLKDGTVLC 199 K T + + S+ +A S N + E ++ L LF D++KDG +LC Sbjct: 104 KTSTTTFHHSINESEKASYVSHINSYLKDEPN--LKSYLPINPTTNALF-DLVKDGVLLC 160 Query: 200 QLINKLKPGSVPK--INTTG--GQFKMMENITNFQSAIKAYGVPDIDV 331 +LIN PG++ + INT ++ EN++ ++ KA G +++ Sbjct: 161 KLINIAVPGTIDERAINTKKELNPWERTENLSLCLNSAKAIGCTVVNI 208 >At3g44730.1 68416.m04814 kinesin motor protein-related similar to 4 other kinesin-like proteins of A. thaliana: F02P16.12 (PID:g2191180), katA (D11371), katB (D21137), and katC (D21138); contains non-consensus AT-AC splice sites at intron 10 Length = 1087 Score = 33.9 bits (74), Expect = 0.12 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +2 Query: 149 PPGELFEDVLKDGTVLCQLINKLKPGSVPKI 241 P + F L++G +LC ++NK+ PGSV K+ Sbjct: 13 PSEDEFSLALRNGLILCNVLNKVNPGSVLKV 43 >At4g26700.1 68417.m03848 fimbrin-like protein (FIM1) identical to fimbrin-like protein (ATFIM1) [Arabidopsis thaliana] GI:2905893 Length = 687 Score = 33.1 bits (72), Expect = 0.20 Identities = 25/70 (35%), Positives = 41/70 (58%), Gaps = 4/70 (5%) Frame = +2 Query: 158 ELFEDVLKDGTVLCQLINKLKPGSVPK--INTTG--GQFKMMENITNFQSAIKAYGVPDI 325 +L+E ++KDG +LC+LIN PG++ + INT ++ EN T ++ KA G + Sbjct: 155 QLYE-LVKDGVLLCKLINVAVPGTIDERAINTKRVLNPWERNENHTLCLNSAKAVGCSVV 213 Query: 326 DVFQTVDLWE 355 ++ T DL E Sbjct: 214 NI-GTQDLAE 222 >At5g55400.1 68418.m06902 fimbrin-like protein, putative similar to fimbrin-like protein (ATFIM1) [Arabidopsis thaliana] GI:2905893; contains Pfam profile PF00307: Calponin homology (CH) domain Length = 714 Score = 32.7 bits (71), Expect = 0.27 Identities = 25/70 (35%), Positives = 41/70 (58%), Gaps = 4/70 (5%) Frame = +2 Query: 158 ELFEDVLKDGTVLCQLINKLKPGSVPK--INTTG--GQFKMMENITNFQSAIKAYGVPDI 325 +L+E ++KDG +LC+LIN PG++ + INT ++ EN T ++ KA G + Sbjct: 156 DLYE-LVKDGVLLCKLINIAVPGTIDERAINTKRVLNPWERNENHTLCLNSAKAVGCSVV 214 Query: 326 DVFQTVDLWE 355 ++ T DL E Sbjct: 215 NI-GTQDLAE 223 >At5g04980.1 68418.m00527 endonuclease/exonuclease/phosphatase family protein contains similarity to inositol polyphosphate 5-phosphatase I (GI:10444261) and II (GI:10444263) [Arabidopsis thaliana]; contains Pfam profile PF03372: Endonuclease/Exonuclease/phosphatase family Length = 437 Score = 30.7 bits (66), Expect = 1.1 Identities = 27/85 (31%), Positives = 42/85 (49%), Gaps = 4/85 (4%) Frame = -2 Query: 246 VLILG-TEPGFSLLMSWQRTVPSLRTSSNSSPGGNLAPRTPSIHSWASFSFSGLRLEAIL 70 VL+LG EP W + S+SS GG L+P+TPS + + F F+ L+ I Sbjct: 57 VLVLGDNEPA----AKWLAMINQSLNKSSSSSGGRLSPKTPSFGAGSMF-FAKPSLKKIS 111 Query: 69 A--RT*RSRDM-LCDCVSAFXRVLR 4 RT R + +C+C + ++R Sbjct: 112 ESFRTECRRKLKICNCSTFSEDIVR 136 >At4g35800.1 68417.m05087 DNA-directed RNA polymerase II largest subunit (RPB205) (RPII) (RPB1) nearly identical to P|P18616 DNA-directed RNA polymerase II largest subunit (EC 2.7.7.6) {Arabidopsis thaliana} Length = 1840 Score = 29.9 bits (64), Expect = 1.9 Identities = 35/117 (29%), Positives = 54/117 (46%), Gaps = 11/117 (9%) Frame = +2 Query: 62 VRAKIASKRNPEKEK---EAQEWIEGVLGAKF-----PPGELFEDVLKD--GTVLCQL-I 208 +R+ +ASKR E+ K EA EW+ G + ++F PGE+ V G Q+ + Sbjct: 1043 LRSTLASKRVLEEYKLSREAFEWVIGEIESRFLQSLVAPGEMIGCVAAQSIGEPATQMTL 1102 Query: 209 NKLKPGSVPKINTTGGQFKMMENITNFQSAIKAYGVPDIDVFQTVDLWEKKDIAQVV 379 N V N T G ++ E I N IK P + V+ T + + K+ A+ V Sbjct: 1103 NTFHYAGVSAKNVTLGVPRLRE-IINVAKRIK---TPSLSVYLTPEASKSKEGAKTV 1155 >At5g02790.1 68418.m00221 In2-1 protein, putative similar to In2-1, Zea mays, EMBL:X58573 Length = 235 Score = 29.1 bits (62), Expect = 3.3 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = +2 Query: 410 YRHAEWSGPCLGPKPADECKRDFSDEVLKAGQTVIGLQAGSNKG 541 Y + GP L P+ D KR+F DE+LK T + S KG Sbjct: 99 YLDNTFEGPSLYPE--DHAKREFGDELLKYTDTFVKTMYVSLKG 140 >At5g02780.1 68418.m00220 In2-1 protein, putative similar to In2-1 [Zea mays] EMBL:X58573 Length = 237 Score = 29.1 bits (62), Expect = 3.3 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +2 Query: 410 YRHAEWSGPCLGPKPADECKRDFSDEVLK-AGQTVIGLQAGSNKG 541 Y + + GP L P+ D KR+F +E+LK +T + GS KG Sbjct: 101 YVDSNFDGPSLYPE--DSAKREFGEELLKYVDETFVKTVFGSFKG 143 >At3g12580.1 68416.m01567 heat shock protein 70, putative / HSP70, putative strong similarity to heat shock protein GI:425194 [Spinacia oleracea] Length = 650 Score = 28.7 bits (61), Expect = 4.4 Identities = 19/67 (28%), Positives = 35/67 (52%), Gaps = 5/67 (7%) Frame = +2 Query: 71 KIASKRNPEKEKEAQEWIEGVL----GAKFPPGELFEDVLKDGTVLCQ-LINKLKPGSVP 235 KIASK + +K+ ++ I+ + G + + FED +K+ LC +I ++ G+ P Sbjct: 563 KIASKLDAADKKKIEDAIDQAIEWLDGNQLAEADEFEDKMKELESLCNPIIARMYQGAGP 622 Query: 236 KINTTGG 256 + GG Sbjct: 623 DMGGAGG 629 >At4g33650.1 68417.m04780 dynamin-like protein 2a (ADL2a) identical to dynamin like protein 2a (ADL2a) [Arabidopsis thaliana] GI:19032337; supported by cDNA gi:19032336 Length = 808 Score = 28.3 bits (60), Expect = 5.8 Identities = 33/107 (30%), Positives = 47/107 (43%), Gaps = 11/107 (10%) Frame = -2 Query: 528 PACRPITVCPAFRTSSEKSRLHSSAGLGPR-------QGPLHSACL*VSRPRANSVLTTW 370 P RP RTSS S++ S + LG + QG + SA ++P AN+ T W Sbjct: 551 PVARPKDTVEPDRTSSSTSQVKSRSFLGRQANGIVTDQGVV-SADAEKAQPAANASDTRW 609 Query: 369 AM-SFFSHRST--VWNTSMSGTPYA-LIADWKFVMFSIILNCPPVVL 241 + S F T V S+ P++ + D + I L PP VL Sbjct: 610 GIPSIFRGGDTRAVTKDSLLNKPFSEAVEDMSHNLSMIYLKEPPAVL 656 >At3g49210.1 68416.m05378 expressed protein Length = 518 Score = 28.3 bits (60), Expect = 5.8 Identities = 19/68 (27%), Positives = 36/68 (52%), Gaps = 2/68 (2%) Frame = -2 Query: 366 MSFFSHRSTVWNTSMSGTPYALIADWKFVM--FSIILNCPPVVLILGTEPGFSLLMSWQR 193 +SF+ H T S+ G P+AL ++ M +I L P V+ ++P LL W++ Sbjct: 445 ISFYGHPITYMAPSVYGHPHALTMHFQSYMNQMTISLTVDPTVI---SDP-HRLLDDWEK 500 Query: 192 TVPSLRTS 169 ++ S++ + Sbjct: 501 SLQSIKAA 508 >At5g67270.1 68418.m08480 microtubule-associated EB1 family protein similar to SP|Q9UPY8 Microtubule-associated protein RP/EB family member 3 (Protein EB3) {Homo sapiens}; contains Pfam profiles PF00307: Calponin homology (CH) domain, PF03271: EB1 protein Length = 329 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/34 (38%), Positives = 23/34 (67%), Gaps = 3/34 (8%) Frame = +2 Query: 185 GTVLCQLINKLKPGSVP--KIN-TTGGQFKMMEN 277 G V CQL++ + PG+VP K+N +++M++N Sbjct: 40 GAVHCQLMDSVHPGTVPMHKVNFDAKSEYEMIQN 73 >At5g14570.1 68418.m01708 transporter, putative similar to trans-membrane nitrate transporter protein AtNRT2:1 [Arabidopsis thaliana] GI:3747058, high-affinity nitrate transporter ACH1 [Arabidopsis thaliana] GI:3608362; contains Pfam profile PF00083: Sugar (and other) transporter Length = 493 Score = 27.9 bits (59), Expect = 7.6 Identities = 26/104 (25%), Positives = 48/104 (46%), Gaps = 2/104 (1%) Frame = +2 Query: 188 TVLCQLINKLKPGSVPKINTTGGQFKMMENITNFQSAIKAYGVPDIDVFQTVDLWEKKDI 367 +V Q + L G VP ++T ++ IT + A V +F D+ +++ I Sbjct: 375 SVFVQAASGLVFGVVPFVSTRS--LGVVAGITGSGGTVGAV-VTQFLLFSGDDVRKQRSI 431 Query: 368 AQV--VSTLFALGRETYRHAEWSGPCLGPKPADECKRDFSDEVL 493 + + ++ +FAL + +W G C GP + E + D S +L Sbjct: 432 SLMGLMTFVFALSVTSIYFPQWGGMCCGPSSSSE-EEDISRGLL 474 >At5g07640.1 68418.m00875 zinc finger (C3HC4-type RING finger) family protein contains a zinc finger, C3HC4 type (RING finger), signature, PROSITE:PS00518 and a IBR domain, Pfam:PF01485 Length = 316 Score = 27.9 bits (59), Expect = 7.6 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 3/46 (6%) Frame = -2 Query: 564 RFCPD*VAPLLDPA---CRPITVCPAFRTSSEKSRLHSSAGLGPRQ 436 RFC D + D A +P+ CP+F +SE R L P+Q Sbjct: 178 RFCFDCIKKQADVALEFAKPVVNCPSFGCNSELQREDCEGVLKPKQ 223 >At3g08590.2 68416.m00998 2,3-biphosphoglycerate-independent phosphoglycerate mutase, putative / phosphoglyceromutase, putative strong similarity to SP|Q42908 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC 5.4.2.1) (Phosphoglyceromutase) {Mesembryanthemum crystallinum}; contains Pfam profile PF01676: Metalloenzyme superfamily Length = 560 Score = 27.9 bits (59), Expect = 7.6 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Frame = +2 Query: 446 PKPADECKRDFSDE---VLKAGQTVIGLQAGSNKGATQSGQN-LGAGR 577 P PA + +D + ++KA T +GL + + G ++ G N LGAGR Sbjct: 46 PTPAMDSLKDGKPDTWRLIKAHGTAVGLPSEDDMGNSEVGHNALGAGR 93 >At3g08590.1 68416.m00997 2,3-biphosphoglycerate-independent phosphoglycerate mutase, putative / phosphoglyceromutase, putative strong similarity to SP|Q42908 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC 5.4.2.1) (Phosphoglyceromutase) {Mesembryanthemum crystallinum}; contains Pfam profile PF01676: Metalloenzyme superfamily Length = 560 Score = 27.9 bits (59), Expect = 7.6 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Frame = +2 Query: 446 PKPADECKRDFSDE---VLKAGQTVIGLQAGSNKGATQSGQN-LGAGR 577 P PA + +D + ++KA T +GL + + G ++ G N LGAGR Sbjct: 46 PTPAMDSLKDGKPDTWRLIKAHGTAVGLPSEDDMGNSEVGHNALGAGR 93 >At1g09780.1 68414.m01097 2,3-biphosphoglycerate-independent phosphoglycerate mutase, putative / phosphoglyceromutase, putative strong similarity to SP|Q42908 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC 5.4.2.1) (Phosphoglyceromutase) {Mesembryanthemum crystallinum}; contains Pfam profile PF01676: Metalloenzyme superfamily Length = 557 Score = 27.9 bits (59), Expect = 7.6 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 4/48 (8%) Frame = +2 Query: 446 PKPA-DECKRDFSDE--VLKAGQTVIGLQAGSNKGATQSGQN-LGAGR 577 P PA D K D ++KA T +GL + + G ++ G N LGAGR Sbjct: 44 PTPAMDSLKHGAPDTWTLIKAHGTAVGLPSEDDMGNSEVGHNALGAGR 91 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,011,922 Number of Sequences: 28952 Number of extensions: 390599 Number of successful extensions: 1131 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 1102 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1128 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1663169840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -