BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30902 (818 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC576.17c |||membrane transporter|Schizosaccharomyces pombe|ch... 26 5.6 SPAC19D5.10c |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 26 7.4 >SPCC576.17c |||membrane transporter|Schizosaccharomyces pombe|chr 3|||Manual Length = 525 Score = 26.2 bits (55), Expect = 5.6 Identities = 17/59 (28%), Positives = 29/59 (49%) Frame = -1 Query: 326 AYRLAGGACVWCAHPSTFSGQSQTFSLGLNTRLDGHGMWCFRSPSHM*YMVQSAWSLWY 150 AY+LAG + AHP + + + + L+T L M+ F +P+ + S LW+ Sbjct: 58 AYKLAGISNEHPAHPQNWGWWKKAYIVLLSTSLQ---MYVFWTPNFYPGVQDSVMELWH 113 >SPAC19D5.10c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 87 Score = 25.8 bits (54), Expect = 7.4 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +1 Query: 493 TWMTHLVHSNNIFNSLLQRFIV 558 +W HL+H NIF+ + F++ Sbjct: 56 SWSRHLIHGINIFSFSISLFLI 77 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,992,004 Number of Sequences: 5004 Number of extensions: 58481 Number of successful extensions: 150 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 146 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 150 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 400438000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -