BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30902 (818 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0606 - 4461646-4462623 29 3.4 09_04_0362 - 16953108-16953155,16953478-16953562,16953626-169537... 28 7.8 >03_01_0606 - 4461646-4462623 Length = 325 Score = 29.5 bits (63), Expect = 3.4 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -1 Query: 326 AYRLAGGACVWCAHPSTFSGQSQTFSLGLNT 234 AY GG+C+W ST + + T+S +T Sbjct: 209 AYTAVGGSCIWMTVQSTVAAAAGTYSFDTST 239 >09_04_0362 - 16953108-16953155,16953478-16953562,16953626-16953702, 16954601-16954641,16955140-16955644,16955897-16956316 Length = 391 Score = 28.3 bits (60), Expect = 7.8 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = -1 Query: 290 AHPSTFSGQSQTFSLGLNTRLDGHGMWCFRSPSHM*YMVQSAWSLW 153 A S+F G S S+ + +L HG WC S+ Y + +A W Sbjct: 313 ASGSSFGGTSLLGSMHRDGQLQHHGDWCGIDASYSRYHLTNARCAW 358 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,733,677 Number of Sequences: 37544 Number of extensions: 349072 Number of successful extensions: 723 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 697 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 723 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2244686244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -