BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30901 (758 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC4F6.17c |||mitochondrial matrix chaperone Hsp78 |Schizosacch... 28 1.3 SPACUNK4.14 |mdb1||BRCT domain protein|Schizosaccharomyces pombe... 26 6.7 >SPBC4F6.17c |||mitochondrial matrix chaperone Hsp78 |Schizosaccharomyces pombe|chr 2|||Manual Length = 803 Score = 28.3 bits (60), Expect = 1.3 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -1 Query: 425 RHAIMDVVDRDNSTEYLRRSENQTVYIEFKTSNAAYITRV 306 R A+MDVV + E+L R ++Q V+ + N I V Sbjct: 672 RDAVMDVVQKYYPPEFLNRIDDQIVFNKLSEKNLEDIVNV 711 >SPACUNK4.14 |mdb1||BRCT domain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 520 Score = 25.8 bits (54), Expect = 6.7 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = -3 Query: 582 NKTSEMS*ISYSWNFPSTLNRALCCNLKNVQSTTIHTKRKH 460 N+ +E + IS +++FPS+ KNVQS+ + K KH Sbjct: 244 NREAEEAPISTNYSFPSSSLEDQPD--KNVQSSAVENKNKH 282 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,945,788 Number of Sequences: 5004 Number of extensions: 59133 Number of successful extensions: 119 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 117 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 119 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 363302114 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -