BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30900 (757 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-12|CAD27934.1| 160|Anopheles gambiae putative MLC1 pro... 188 1e-49 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 26 1.1 AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylch... 25 3.3 AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylch... 25 3.3 AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 24 5.8 AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylch... 24 5.8 AY187043-1|AAO39757.1| 171|Anopheles gambiae putative antennal ... 23 7.7 AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-b... 23 7.7 >AJ439353-12|CAD27934.1| 160|Anopheles gambiae putative MLC1 protein protein. Length = 160 Score = 188 bits (459), Expect = 1e-49 Identities = 88/148 (59%), Positives = 108/148 (72%) Frame = +1 Query: 46 SDLSKNDVERASFAFSIYDFEGKGKIDAFNLGDLLRALNSNPTLATIXXXXXXXXXXXXX 225 +DL ++E+A F FS+YD+EG G++DA +LG+ LRALN NPT+ I Sbjct: 3 NDLKDVEIEKAQFVFSVYDWEGSGQMDAMDLGNALRALNLNPTIELIGKMGGTQKRGEKK 62 Query: 226 XXXXXFLPIYSQAKKDKDQGAYEDFLECLKLYDKNENGLMLGAELTHTLLALGEKLDDSE 405 FLPI+SQ KK+K+QG +EDFLECLKLYDKNE+G ML AELTH+L ALGE+LDD E Sbjct: 63 IKFEEFLPIFSQVKKEKEQGCFEDFLECLKLYDKNEDGTMLLAELTHSLTALGERLDDVE 122 Query: 406 VAEVTKDCMDPEDDDGMIPYAAFLKKVM 489 + V KDCMDPEDDDG IPYA FLKK+M Sbjct: 123 LDNVMKDCMDPEDDDGNIPYAPFLKKMM 150 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 26.2 bits (55), Expect = 1.1 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +1 Query: 382 GEKLDDSEVAEVTKDCMDPEDDDG 453 G K+++ +AEV K +D EDD G Sbjct: 1250 GLKMENGVIAEVEKSQVDGEDDTG 1273 >AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 24.6 bits (51), Expect = 3.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +2 Query: 671 HVDIPYNILNTDNPLFYTNNII 736 ++DI +NI LFYT NII Sbjct: 230 YLDITFNITMRRKTLFYTVNII 251 >AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 24.6 bits (51), Expect = 3.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +2 Query: 671 HVDIPYNILNTDNPLFYTNNII 736 ++DI +NI LFYT NII Sbjct: 230 YLDITFNITMRRKTLFYTVNII 251 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 23.8 bits (49), Expect = 5.8 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +2 Query: 671 HVDIPYNILNTDNPLFYTNNII 736 ++DI +NI LFYT N+I Sbjct: 226 YLDITFNITMRRKTLFYTVNLI 247 >AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 2 protein. Length = 569 Score = 23.8 bits (49), Expect = 5.8 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +2 Query: 653 PARASSHVDIPYNILNTDNPLFYTNNII 736 P A + DI +NI LFYT N+I Sbjct: 233 PCCAEPYPDIFFNITLRRKTLFYTVNLI 260 >AY187043-1|AAO39757.1| 171|Anopheles gambiae putative antennal carrier protein AP-1 protein. Length = 171 Score = 23.4 bits (48), Expect = 7.7 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +1 Query: 352 AELTHTLLALGEKLDDSEVAEVTKDCMDP 438 AE ++ DD +VT++C+DP Sbjct: 64 AESFKCVIVKNSTKDDVNKVQVTRECLDP 92 >AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-binding protein OBPjj17 protein. Length = 285 Score = 23.4 bits (48), Expect = 7.7 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = -2 Query: 399 VVKLLT*CKKRVCELSAKHETVFVLVIQLQTFQEIF 292 V+K L+ CK +V +L +H + Q + ++IF Sbjct: 130 VLKALSYCKPKVTQLQGRHVRTDEEMEQCEIAEDIF 165 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 706,015 Number of Sequences: 2352 Number of extensions: 12515 Number of successful extensions: 34 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78170964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -