BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30889 (762 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT001614-1|AAN71369.1| 867|Drosophila melanogaster RE33889p pro... 32 0.74 AE013599-3901|AAF47228.1| 867|Drosophila melanogaster CG11414-P... 32 0.74 >BT001614-1|AAN71369.1| 867|Drosophila melanogaster RE33889p protein. Length = 867 Score = 32.3 bits (70), Expect = 0.74 Identities = 21/74 (28%), Positives = 32/74 (43%), Gaps = 1/74 (1%) Frame = +1 Query: 403 NVDVFPCGDLVPYACVECKIEFPIQ*NNNTCIIMCKYSKIIQS*YRLLSKMPKERYYFMN 582 NV++F GD C EC + N C I C++ ++ L K+P N Sbjct: 54 NVEIFSIGDCDHPVCYECSTRMRVLCQQNECPI-CRH--VLSKVLFTLDKLPYRELEANN 110 Query: 583 KSFLY-RSVSVIFC 621 +S LY + + FC Sbjct: 111 RSDLYSKKYRIGFC 124 >AE013599-3901|AAF47228.1| 867|Drosophila melanogaster CG11414-PA protein. Length = 867 Score = 32.3 bits (70), Expect = 0.74 Identities = 21/74 (28%), Positives = 32/74 (43%), Gaps = 1/74 (1%) Frame = +1 Query: 403 NVDVFPCGDLVPYACVECKIEFPIQ*NNNTCIIMCKYSKIIQS*YRLLSKMPKERYYFMN 582 NV++F GD C EC + N C I C++ ++ L K+P N Sbjct: 54 NVEIFSIGDCDHPVCYECSTRMRVLCQQNECPI-CRH--VLSKVLFTLDKLPYRELEANN 110 Query: 583 KSFLY-RSVSVIFC 621 +S LY + + FC Sbjct: 111 RSDLYSKKYRIGFC 124 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,920,141 Number of Sequences: 53049 Number of extensions: 621944 Number of successful extensions: 1174 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1138 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1174 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3499501170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -