BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30887 (769 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 23 2.0 EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 23 2.0 AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory recept... 23 3.6 AJ969955-1|CAI94742.1| 160|Tribolium castaneum torso-like prote... 21 8.2 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 23.4 bits (48), Expect = 2.0 Identities = 14/47 (29%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = -2 Query: 621 LRAPPEELSPPRALPAPVPQSRASVF*G--PSHRTFVAGKDLITKDM 487 ++A PE++S R P P F G +R F A T+D+ Sbjct: 513 IKADPEKISAIRNFPVPQKTKHVRAFLGLCNFYRKFCARYSAATQDL 559 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 23.4 bits (48), Expect = 2.0 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +1 Query: 469 EDITTRHIFSYKILSCDE 522 E+ TRH+ +I+ CD+ Sbjct: 250 EEYVTRHLIDGRIIGCDQ 267 >AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory receptor candidate 42 protein. Length = 347 Score = 22.6 bits (46), Expect = 3.6 Identities = 13/65 (20%), Positives = 31/65 (47%) Frame = -1 Query: 427 AVIVFRVHAVLCDFSDFTVVKLLT*CKKRVCELSAKHETVFVLVIQLQTFQEIFIRSLVF 248 +++ + ++ FS +TV+ + +++ C+L +K LV TF +L + Sbjct: 63 SIVAMVMGTIVNAFSCYTVLAPVLCKRQQYCQLMSKLLGNHQLVYNCHTFGRFLAPNLTY 122 Query: 247 VFLCL 233 + + L Sbjct: 123 LLVAL 127 Score = 22.2 bits (45), Expect = 4.7 Identities = 9/40 (22%), Positives = 21/40 (52%) Frame = -1 Query: 409 VHAVLCDFSDFTVVKLLT*CKKRVCELSAKHETVFVLVIQ 290 ++ VL ++ DF+ + K + ++ T F+++IQ Sbjct: 303 INVVLNNYPDFSAAGFFSINKTTLLQIIGNVTTFFIIIIQ 342 >AJ969955-1|CAI94742.1| 160|Tribolium castaneum torso-like protein protein. Length = 160 Score = 21.4 bits (43), Expect = 8.2 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = +1 Query: 109 PWRSPESAQLKPHTGNH 159 PW + Q+K +GNH Sbjct: 141 PWFAEHMGQIKVASGNH 157 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,818 Number of Sequences: 336 Number of extensions: 3040 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20650031 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -