BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30885 (525 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13545| Best HMM Match : Peptidase_M49 (HMM E-Value=0) 30 1.0 SB_28910| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_53355| Best HMM Match : CHCH (HMM E-Value=3.3e-07) 28 4.1 SB_24669| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_22561| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_57588| Best HMM Match : Vicilin_N (HMM E-Value=1.4) 28 5.4 SB_52932| Best HMM Match : Ank (HMM E-Value=0) 28 5.4 SB_37813| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_42244| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_19798| Best HMM Match : Calx-beta (HMM E-Value=6.3e-12) 27 7.2 SB_26631| Best HMM Match : ig (HMM E-Value=1.6e-22) 27 7.2 SB_56544| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 >SB_13545| Best HMM Match : Peptidase_M49 (HMM E-Value=0) Length = 488 Score = 30.3 bits (65), Expect = 1.0 Identities = 13/28 (46%), Positives = 21/28 (75%) Frame = +2 Query: 44 SEFDASPDGAYNYNFETSNGIVRSETGE 127 +E DA PDG+YN++ ++ +V +ETGE Sbjct: 218 TEEDAKPDGSYNFDHKS---VVNTETGE 242 >SB_28910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 417 Score = 29.5 bits (63), Expect = 1.8 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +2 Query: 11 PPTEDYPKIVRSEFDASPDGAY 76 PPT+DY + RS+ D S DG Y Sbjct: 17 PPTKDYDRRSRSQDDDSDDGCY 38 >SB_53355| Best HMM Match : CHCH (HMM E-Value=3.3e-07) Length = 599 Score = 28.3 bits (60), Expect = 4.1 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Frame = +2 Query: 59 SPDGAYNYNFETSNGIVRSETGELKEALDDDNKPHVIVAVR-GSYSYTNTDGKPETITYF 235 SP G Y E + I R E +L +K H ++AVR G Y + D T+T+ Sbjct: 94 SPSGHYYKVCEPNFFIGRDENLDLTLKSRSVDKKHAVIAVRDGRYELYDMDSLNGTVTHS 153 Query: 236 A 238 A Sbjct: 154 A 154 >SB_24669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 28.3 bits (60), Expect = 4.1 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +1 Query: 49 IRRQPRWSLQLQFRDFQRHRA*RNW*AEGGSRRRQ 153 +RR+ WS+Q++ + RH + W GG ++R+ Sbjct: 3 VRRKDAWSMQVRQVEHPRHSYVQMWRKFGGPKKRE 37 >SB_22561| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 310 Score = 28.3 bits (60), Expect = 4.1 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +2 Query: 47 EFDASPDGAYNYNFETSNGIVRSETGELKEALDDDNKPHVIVA 175 E D+ YNY+ NG+ S+ G+L DN HV+ A Sbjct: 65 EPDSEQADGYNYDTSHHNGVATSQRGQLARLAMGDNN-HVLNA 106 >SB_57588| Best HMM Match : Vicilin_N (HMM E-Value=1.4) Length = 756 Score = 27.9 bits (59), Expect = 5.4 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +1 Query: 133 GGSRRRQQASRYCCCA 180 GGSRRR S++CC A Sbjct: 97 GGSRRRNSKSKFCCFA 112 >SB_52932| Best HMM Match : Ank (HMM E-Value=0) Length = 1266 Score = 27.9 bits (59), Expect = 5.4 Identities = 17/51 (33%), Positives = 23/51 (45%) Frame = +2 Query: 95 SNGIVRSETGELKEALDDDNKPHVIVAVRGSYSYTNTDGKPETITYFADET 247 S + + TG K LDD KPHV+ ++ SY D E + ET Sbjct: 204 SKTVTKMFTGFRKLTLDDLRKPHVVKDIQ-SYILNRLDDDSELRKHLTRET 253 >SB_37813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 450 Score = 27.9 bits (59), Expect = 5.4 Identities = 15/50 (30%), Positives = 29/50 (58%), Gaps = 4/50 (8%) Frame = +2 Query: 59 SPDGAYNYNFETSNGIVRS----ETGELKEALDDDNKPHVIVAVRGSYSY 196 SPDG + NFE NG + + + +A++ D++ V+V ++G Y++ Sbjct: 205 SPDGICSVNFEFYNGAMSTAQCRRLSSVLQAVERDDRVKVVV-LKGGYNF 253 >SB_42244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 870 Score = 27.5 bits (58), Expect = 7.2 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = -1 Query: 471 FVHDILKTQQIVKKNVQKNMAVSIKLITSNKRMWWMLRH 355 F ++L ++++ N+Q++ VS +L S K M +L H Sbjct: 811 FQDELLMLDELIQGNIQRSQLVSEQLSDSRKTMVKVLEH 849 >SB_19798| Best HMM Match : Calx-beta (HMM E-Value=6.3e-12) Length = 185 Score = 27.5 bits (58), Expect = 7.2 Identities = 12/42 (28%), Positives = 22/42 (52%) Frame = -1 Query: 468 VHDILKTQQIVKKNVQKNMAVSIKLITSNKRMWWMLRHTILY 343 VH I Q++++ N +KN + + + WW LR+ + Y Sbjct: 139 VHTIF--QRLLRPNQRKNSPKKLFSACHSTKRWWRLRNVLAY 178 >SB_26631| Best HMM Match : ig (HMM E-Value=1.6e-22) Length = 1123 Score = 27.5 bits (58), Expect = 7.2 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 177 CVEATVTRTLTANLKPLRTSLTRLDT 254 C T +T N KP +TSLTRL++ Sbjct: 348 CPVDTKAMNITVNYKPEKTSLTRLES 373 >SB_56544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 27.1 bits (57), Expect = 9.5 Identities = 17/58 (29%), Positives = 23/58 (39%), Gaps = 3/58 (5%) Frame = +2 Query: 2 IAAPPTEDYPKIVRSEF---DASPDGAYNYNFETSNGIVRSETGELKEALDDDNKPHV 166 ++A DY V E ASP N ET + E K +D N+PH+ Sbjct: 481 VSASSPLDYVAFVNREVLFPAASPINMVNITIETDGRVESHEVFRAKLTVDTANRPHI 538 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,718,286 Number of Sequences: 59808 Number of extensions: 273562 Number of successful extensions: 783 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 670 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 781 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1184975377 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -