BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30881 (754 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 25 1.0 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 25 1.0 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 23 3.1 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 4.1 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 4.1 DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. 22 5.4 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 22 5.4 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 5.4 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 9.4 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 24.6 bits (51), Expect = 1.0 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +1 Query: 25 PRHHTTLFNYDRYLTEYEHDID 90 PRH + L N + +T++E D+D Sbjct: 175 PRHASDLDNCNHLMTKFEPDLD 196 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 24.6 bits (51), Expect = 1.0 Identities = 18/56 (32%), Positives = 23/56 (41%), Gaps = 4/56 (7%) Frame = +3 Query: 243 FPNSCRPTLTPSRFTTTLSLPLR----GLRYPATVTCLSIARSTATPRALSMPTTT 398 F +SC P P S PL PAT+T + +T T A + TTT Sbjct: 75 FSSSCDPV--PGNLEQIGSRPLHPPASSTSLPATITTTTTTTTTTTATAAATATTT 128 Score = 22.6 bits (46), Expect = 4.1 Identities = 17/57 (29%), Positives = 25/57 (43%) Frame = +3 Query: 372 RALSMPTTTLALSIITGQSTTCQDACDVELIPSTPTRHGRTISTGWLPSTGCTHLAT 542 +A S +T A TG +TT A P+TP+ T + +TG T + T Sbjct: 207 KAGSTDASTPATVTTTGATTTLPAASATGTGPATPSAVVATSNATAAMTTGTTTIPT 263 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 23.0 bits (47), Expect = 3.1 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +2 Query: 599 DPLKPKSLKGIEYEPDN 649 D KP++ KGI EP N Sbjct: 550 DSTKPETSKGINAEPSN 566 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.6 bits (46), Expect = 4.1 Identities = 14/39 (35%), Positives = 18/39 (46%), Gaps = 5/39 (12%) Frame = -3 Query: 530 GTAGRWQPACRDGPAMPCGRRRDQL-----HVARVLARG 429 G AG WQ GP +P D+L + RV+A G Sbjct: 948 GDAGIWQQQEFTGPPLPYAALIDELKPATRYTIRVIAEG 986 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.6 bits (46), Expect = 4.1 Identities = 14/39 (35%), Positives = 18/39 (46%), Gaps = 5/39 (12%) Frame = -3 Query: 530 GTAGRWQPACRDGPAMPCGRRRDQL-----HVARVLARG 429 G AG WQ GP +P D+L + RV+A G Sbjct: 944 GDAGIWQQQEFTGPPLPYAALIDELKPATRYTIRVIAEG 982 >DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. Length = 132 Score = 22.2 bits (45), Expect = 5.4 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -2 Query: 237 LRRVGLYLSSALMSSEPFRERT 172 L++VG + + E FRERT Sbjct: 67 LKKVGFVNADTTFNEEKFRERT 88 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +1 Query: 172 RAFSKRFGRHQSRGKVQANTPQRFSRTPVDLP 267 +AF+++ + S GK+ A P FS P Sbjct: 337 KAFARKKTDYSSFGKILATEPTLFSNVTPKFP 368 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.2 bits (45), Expect = 5.4 Identities = 16/71 (22%), Positives = 30/71 (42%), Gaps = 4/71 (5%) Frame = -1 Query: 544 SVARWVQPVDGSQPVEMVLPCLVGVEGIN----STSHASWHVVDWPVIIERARVVVGIDR 377 S+ + +P+ + LP G +N T+ W ++D + +R +D Sbjct: 1054 SMEKGTRPMIPDDNTSLALPKNEGPFRLNVETAKTNEEMWELIDTEKLTDRLPYPWTMDN 1113 Query: 376 ARGVAVDLAMD 344 R V VD+ M+ Sbjct: 1114 ERYVKVDMYMN 1124 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 9.4 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -2 Query: 660 QWGLLSGSYSMPFRLLGLRGSM 595 Q+G G Y P+ G RGS+ Sbjct: 1819 QYGSQYGQYGAPYDHYGSRGSV 1840 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 211,471 Number of Sequences: 438 Number of extensions: 4944 Number of successful extensions: 14 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23632110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -