BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30874 (737 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY645022-1|AAT92558.1| 165|Anopheles gambiae hairy protein. 25 2.4 AJ973475-1|CAJ01522.1| 127|Anopheles gambiae hypothetical prote... 24 4.3 AJ697728-1|CAG26921.1| 127|Anopheles gambiae putative sensory a... 24 4.3 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 24 4.3 AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 24 4.3 AY994094-1|AAX86007.1| 41|Anopheles gambiae metallothionein 2 ... 24 5.6 AJ973476-1|CAJ01523.1| 126|Anopheles gambiae hypothetical prote... 24 5.6 AJ697729-1|CAG26922.1| 126|Anopheles gambiae putative sensory a... 24 5.6 AF513635-1|AAM53607.1| 212|Anopheles gambiae glutathione S-tran... 23 7.4 AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. 23 7.4 AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. 23 9.8 AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 23 9.8 AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. 23 9.8 >AY645022-1|AAT92558.1| 165|Anopheles gambiae hairy protein. Length = 165 Score = 25.0 bits (52), Expect = 2.4 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +3 Query: 243 SRAPRTSSVIVSQLSSDLSSPKTPLSL 323 S + +SS + S SS SSP +PLSL Sbjct: 112 SSSSSSSSSMSSSSSSSFSSPDSPLSL 138 >AJ973475-1|CAJ01522.1| 127|Anopheles gambiae hypothetical protein protein. Length = 127 Score = 24.2 bits (50), Expect = 4.3 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +2 Query: 563 VDSFRAQWYLQPAKYDKDNLFYIYNREYSK 652 +++ + QW KYD +NL+ RE +K Sbjct: 91 IENRKEQWDALQKKYDPENLYVEKYREEAK 120 >AJ697728-1|CAG26921.1| 127|Anopheles gambiae putative sensory appendage protein SAP-2 protein. Length = 127 Score = 24.2 bits (50), Expect = 4.3 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +2 Query: 563 VDSFRAQWYLQPAKYDKDNLFYIYNREYSK 652 +++ + QW KYD +NL+ RE +K Sbjct: 91 IENRKEQWDALQKKYDPENLYVEKYREEAK 120 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 24.2 bits (50), Expect = 4.3 Identities = 13/55 (23%), Positives = 25/55 (45%), Gaps = 5/55 (9%) Frame = +2 Query: 107 ADYDSAVEKSKHLYEEKKS-----EVITNVVNKLIRNNKMNCMEYAYQLWLQGSK 256 AD+ H+Y E+K ++ N + K R+N + M+Y + + + K Sbjct: 677 ADFCDVWINIAHIYVEQKQYISAIQMYENCLKKFYRHNNVEVMQYLARAYFRAGK 731 >AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CYP9L1 protein protein. Length = 533 Score = 24.2 bits (50), Expect = 4.3 Identities = 18/48 (37%), Positives = 25/48 (52%) Frame = +2 Query: 545 AFGVNSVDSFRAQWYLQPAKYDKDNLFYIYNREYSKALTLSRTLETSG 688 AFGV+ V+SFR DKDN+F+ Y ++ S L L+ G Sbjct: 193 AFGVH-VNSFR----------DKDNVFFRYGKDLSNFSRLKVALKIMG 229 >AY994094-1|AAX86007.1| 41|Anopheles gambiae metallothionein 2 protein. Length = 41 Score = 23.8 bits (49), Expect = 5.6 Identities = 8/22 (36%), Positives = 10/22 (45%) Frame = -1 Query: 674 ASSTVSKPCCIHGCRCRTNCLC 609 A + P C GC C + C C Sbjct: 8 ADCKCTSPNCGAGCGCESRCTC 29 >AJ973476-1|CAJ01523.1| 126|Anopheles gambiae hypothetical protein protein. Length = 126 Score = 23.8 bits (49), Expect = 5.6 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +2 Query: 563 VDSFRAQWYLQPAKYDKDNLFYIYNREYSK 652 +D+ + QW KYD +N++ RE +K Sbjct: 91 IDNRKDQWENLQKKYDPENIYVNKYREDAK 120 >AJ697729-1|CAG26922.1| 126|Anopheles gambiae putative sensory appendage protein SAP-3 protein. Length = 126 Score = 23.8 bits (49), Expect = 5.6 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +2 Query: 563 VDSFRAQWYLQPAKYDKDNLFYIYNREYSK 652 +D+ + QW KYD +N++ RE +K Sbjct: 91 IDNRKDQWENLQKKYDPENIYVNKYREDAK 120 >AF513635-1|AAM53607.1| 212|Anopheles gambiae glutathione S-transferase D4 protein. Length = 212 Score = 23.4 bits (48), Expect = 7.4 Identities = 20/76 (26%), Positives = 33/76 (43%), Gaps = 2/76 (2%) Frame = -3 Query: 705 PQAMRLPEVSSVLDSVKALLYSRL*M*NKLSLSYLAGCRYHWALKLSTLLTPKAM--WSP 532 P ++ + +D +++ LY R SY A + A + L+T A+ W Sbjct: 120 PSEKQVQRLQKAVDVLESFLYER---------SYTAADQLTVA-DICLLVTVNALTLWLG 169 Query: 531 FELVPTPNTKYWLRSV 484 +EL P P + WL V Sbjct: 170 YELAPYPRIRDWLGRV 185 >AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. Length = 786 Score = 23.4 bits (48), Expect = 7.4 Identities = 15/62 (24%), Positives = 27/62 (43%) Frame = +2 Query: 65 NDILEEQLYNSIVVADYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCMEYAYQLWL 244 +D +EQ Y + D + + + +E K E TNV + I ++ + + W Sbjct: 565 DDESKEQTYGDPKIEDNPTESVEIEWSLDETKREAKTNVADDTISESEFYGWDCSDDGWP 624 Query: 245 QG 250 QG Sbjct: 625 QG 626 >AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. Length = 897 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 252 PRTSSVIVSQLSSDLSSPKTPLSLCTSA 335 P +IVS LS D ++ TPL++ + A Sbjct: 116 PVKGQIIVSLLSRDSATGGTPLAIVSPA 143 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 4/33 (12%) Frame = +1 Query: 157 EERSHHKCSEQTDT----KQQDELHGVRLSTLA 243 EE+ H +C++Q++T KQ ++ S LA Sbjct: 484 EEKHHERCAKQSETTRIEKQLEQFESAPRSKLA 516 >AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. Length = 1036 Score = 23.0 bits (47), Expect = 9.8 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 499 LVTLSVQDLEVDLVVLPQSNELPAD 425 LV +++L V LPQ+NE AD Sbjct: 814 LVDAHLEELRVRFECLPQANESVAD 838 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 699,912 Number of Sequences: 2352 Number of extensions: 13058 Number of successful extensions: 32 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75676146 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -