BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30874 (737 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase p... 26 0.32 AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase p... 26 0.32 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 22 5.2 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 22 6.9 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 22 6.9 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 21 9.1 >AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 26.2 bits (55), Expect = 0.32 Identities = 16/53 (30%), Positives = 24/53 (45%) Frame = -1 Query: 734 GTSGSLYHCIPRPCGYPRFQASSTVSKPCCIHGCRCRTNCLCRI*RAAGTTGL 576 G +G+ C P + R + ++ V K NCL +I +A G TGL Sbjct: 123 GAAGATSLCFVYPLDFARTRLAADVGKAGGEREFTGLGNCLTKIFKADGITGL 175 >AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 26.2 bits (55), Expect = 0.32 Identities = 16/53 (30%), Positives = 24/53 (45%) Frame = -1 Query: 734 GTSGSLYHCIPRPCGYPRFQASSTVSKPCCIHGCRCRTNCLCRI*RAAGTTGL 576 G +G+ C P + R + ++ V K NCL +I +A G TGL Sbjct: 123 GAAGATSLCFVYPLDFARTRLAADVGKAGGEREFTGLGNCLTKIFKADGITGL 175 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 22.2 bits (45), Expect = 5.2 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = -2 Query: 595 LQVPLGSETIDAVDSEGHVVAVRVSTDSQYQILVT 491 L+ P+G+E+ V S G + + D + Q+L+T Sbjct: 38 LERPVGNESEPLVLSFGLTLMQIIDVDEKNQLLIT 72 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.8 bits (44), Expect = 6.9 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +2 Query: 59 VPNDILEEQLYNSIVVADYDSAVEK 133 VP+++ + LYN +VV++ S K Sbjct: 566 VPDEVPSDVLYNRLVVSEDGSETFK 590 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.8 bits (44), Expect = 6.9 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +2 Query: 59 VPNDILEEQLYNSIVVADYDSAVEK 133 VP+++ + LYN +VV++ S K Sbjct: 566 VPDEVPSDVLYNRLVVSEDGSETFK 590 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.4 bits (43), Expect = 9.1 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +2 Query: 473 KILNTERNQYLVLGVGTNSN 532 ++ NT+RN+YL+ N N Sbjct: 366 RVNNTQRNEYLLALSDRNQN 385 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,975 Number of Sequences: 438 Number of extensions: 3706 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23023035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -