BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30874 (737 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g49400.1 68416.m05400 transducin family protein / WD-40 repea... 34 0.086 At5g56690.1 68418.m07076 F-box family protein contains F-box dom... 31 1.1 At1g60170.1 68414.m06778 pre-mRNA processing ribonucleoprotein b... 31 1.1 At5g63450.1 68418.m07965 cytochrome P450, putative 30 1.4 At3g48520.1 68416.m05296 cytochrome P450 family protein similar ... 30 1.8 At2g23240.2 68415.m02776 plant EC metallothionein-like family 15... 30 1.8 At2g23240.1 68415.m02775 plant EC metallothionein-like family 15... 30 1.8 At4g39510.1 68417.m05587 cytochrome P450 family protein contains... 29 2.4 At4g00730.1 68417.m00099 anthocyaninless2 (ANL2) nearly identica... 29 2.4 At5g64820.1 68418.m08155 hypothetical protein 29 4.3 At5g13010.1 68418.m01491 RNA helicase, putative similar to DEAH-... 29 4.3 At1g16280.1 68414.m01949 DEAD/DEAH box helicase, putative simila... 29 4.3 At5g03800.1 68418.m00347 exostosin family protein / pentatricope... 28 5.6 At2g42000.1 68415.m05195 plant EC metallothionein-like family 15... 28 5.6 At5g16590.1 68418.m01942 leucine-rich repeat transmembrane prote... 28 7.4 At2g04620.1 68415.m00470 cation efflux family protein potential ... 28 7.4 At1g06550.1 68414.m00694 enoyl-CoA hydratase/isomerase family pr... 28 7.4 At5g07400.1 68418.m00847 forkhead-associated domain-containing p... 27 9.8 At4g28590.1 68417.m04089 expressed protein 27 9.8 >At3g49400.1 68416.m05400 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); low similarity (47%) to Agamous-like MADS box protein AGL5 (SP:P29385) {Arabidopsis thaliana} Length = 892 Score = 34.3 bits (75), Expect = 0.086 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 8/76 (10%) Frame = -2 Query: 454 LPQSNELPADFRACFVLTVAEGKSAIVAV--------NIITQRQSETVALVHKLNGVFGE 299 L + +LP DF +C + ++ G A+ V N + Q +S+ A+ NG Sbjct: 482 LSSTTDLPDDFLSCLGVALSPGNLAVALVRNFNVELLNPMYQARSQKAAVEFLWNGAQQS 541 Query: 298 DKSELNWETITDDVLG 251 +SE + ET+T+ +LG Sbjct: 542 GESEDSTETVTEAILG 557 >At5g56690.1 68418.m07076 F-box family protein contains F-box domain Pfam:PF00646 Length = 402 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/60 (28%), Positives = 31/60 (51%) Frame = +2 Query: 455 NNKVYFKILNTERNQYLVLGVGTNSNGDHMAFGVNSVDSFRAQWYLQPAKYDKDNLFYIY 634 N+K ++K + +YL + N F +NS+++FR +WY + D+D L I+ Sbjct: 333 NSKSFYK---EKIGEYLPVSWSKNQGSVPKCF-LNSLETFRVKWYYSEEQEDRDFLSLIF 388 >At1g60170.1 68414.m06778 pre-mRNA processing ribonucleoprotein binding region-containing protein similar to U4/U6 snRNP-associated 61 kDa protein [Homo sapiens] GI:18249847; contains Pfam profile PF01798: Putative snoRNA binding domain Length = 485 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/60 (28%), Positives = 28/60 (46%) Frame = +2 Query: 2 PVIVILCLFVASLYAADSDVPNDILEEQLYNSIVVADYDSAVEKSKHLYEEKKSEVITNV 181 P +I+ + V +L S +P D+L++ L D DSA +K E K + N+ Sbjct: 161 PSAIIMVVSVTALTTKGSALPEDVLQKVLEACDRALDLDSARKKVLEFVESKMGSIAPNL 220 >At5g63450.1 68418.m07965 cytochrome P450, putative Length = 510 Score = 30.3 bits (65), Expect = 1.4 Identities = 17/40 (42%), Positives = 25/40 (62%) Frame = +2 Query: 401 GKDKTSPKVSWKFIALWENNKVYFKILNTERNQYLVLGVG 520 G+D TS ++W F L +N+ V KIL+ RN+ LG+G Sbjct: 306 GRDTTSAAMTWLFWLLSQNDDVETKILDELRNKG-SLGLG 344 >At3g48520.1 68416.m05296 cytochrome P450 family protein similar to Cytochrome P450 94A1 (P450-dependent fatty acid omega-hydroxylase) (SP:O81117) {Vicia sativa}; contains Pfam profile: PF00067 cytochrome P450 Length = 506 Score = 29.9 bits (64), Expect = 1.8 Identities = 17/40 (42%), Positives = 24/40 (60%) Frame = +2 Query: 401 GKDKTSPKVSWKFIALWENNKVYFKILNTERNQYLVLGVG 520 G+D TS ++W F L EN+ V KIL E + + LG+G Sbjct: 304 GRDTTSAAMTWLFWLLTENDDVERKILE-EVDPLVSLGLG 342 >At2g23240.2 68415.m02776 plant EC metallothionein-like family 15 protein identical to EC protein homolog 2 (SP:Q42377) {Arabidopsis thaliana}; identical to an EST: GB:X92116:ATECPRHOM; contains a vertebrate metallothionein signature (PS00203); contains Pfam profile PF02068: Plant PEC family metallothionein Length = 84 Score = 29.9 bits (64), Expect = 1.8 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = -1 Query: 713 HCIPRPCGYPRFQASSTVSKPCCIHGCRCRT 621 HC PC P+ Q ++ C GC C T Sbjct: 51 HCGCNPCNCPKTQTQTSAKGCTCGEGCTCAT 81 >At2g23240.1 68415.m02775 plant EC metallothionein-like family 15 protein identical to EC protein homolog 2 (SP:Q42377) {Arabidopsis thaliana}; identical to an EST: GB:X92116:ATECPRHOM; contains a vertebrate metallothionein signature (PS00203); contains Pfam profile PF02068: Plant PEC family metallothionein Length = 85 Score = 29.9 bits (64), Expect = 1.8 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = -1 Query: 713 HCIPRPCGYPRFQASSTVSKPCCIHGCRCRT 621 HC PC P+ Q ++ C GC C T Sbjct: 52 HCGCNPCNCPKTQTQTSAKGCTCGEGCTCAT 82 >At4g39510.1 68417.m05587 cytochrome P450 family protein contains Pfam PF00067: Cytochrome P450; similar to Cytochrome P450 86A2 (SP:O23066) [Arabidopsis thaliana] Length = 508 Score = 29.5 bits (63), Expect = 2.4 Identities = 20/45 (44%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +2 Query: 347 LTLSNDVHGNDGRLAFG-DGKDKTSPKVSWKFIALWENNKVYFKI 478 L S+D D LAF G+D TS +SW F L EN +V KI Sbjct: 293 LNPSDDKFLRDTILAFNLAGRDTTSSALSWFFWLLSENPQVVTKI 337 >At4g00730.1 68417.m00099 anthocyaninless2 (ANL2) nearly identical to Anthocyaninless2 [Arabidopsis thaliana] GI:5702094 Length = 802 Score = 29.5 bits (63), Expect = 2.4 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +2 Query: 482 NTERNQYLVLGVGTNSNGDHMAF 550 N N L L VGTN+NG H AF Sbjct: 270 NHHYNSSLELAVGTNNNGGHFAF 292 >At5g64820.1 68418.m08155 hypothetical protein Length = 145 Score = 28.7 bits (61), Expect = 4.3 Identities = 13/49 (26%), Positives = 25/49 (51%) Frame = -2 Query: 415 CFVLTVAEGKSAIVAVNIITQRQSETVALVHKLNGVFGEDKSELNWETI 269 C ++ + G SA A + ++ E ++V ++G+FG +WE I Sbjct: 15 CIIIILISGVSADGAESDSAAKKEENPSIVKIISGIFGNKFPPSSWELI 63 >At5g13010.1 68418.m01491 RNA helicase, putative similar to DEAH-box RNA helicase [Chlamydomonas reinhardtii] GI:12044832; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain Length = 1226 Score = 28.7 bits (61), Expect = 4.3 Identities = 19/64 (29%), Positives = 35/64 (54%), Gaps = 1/64 (1%) Frame = -2 Query: 550 EGHVVAVRVSTDSQYQILVTLSVQDLEVDLVVLPQSNELPADFRACFVLTVAEG-KSAIV 374 + + A S + + LV+ S +++ +L++LP ++LPAD +A +G + IV Sbjct: 747 QDEIEAACFSLKERMEQLVSSSSREI-TNLLILPIYSQLPADLQAKIFQKPEDGARKCIV 805 Query: 373 AVNI 362 A NI Sbjct: 806 ATNI 809 >At1g16280.1 68414.m01949 DEAD/DEAH box helicase, putative similar to gb|L13612 DEAD-box protein (dbp45A) from Drosophila melanogaster and is a member of PF|00270 DEAD/DEAH box helicase family Length = 491 Score = 28.7 bits (61), Expect = 4.3 Identities = 22/71 (30%), Positives = 33/71 (46%) Frame = -2 Query: 469 VDLVVLPQSNELPADFRACFVLTVAEGKSAIVAVNIITQRQSETVALVHKLNGVFGEDKS 290 VDLV+ P D+ T G+ + AV+IIT+ V L+HK+ G+ Sbjct: 371 VDLVINYDIPRDPRDYVHRVGRTARAGRGGL-AVSIITETD---VKLIHKIEEEVGKKME 426 Query: 289 ELNWETITDDV 257 N + ITD + Sbjct: 427 PYNKKVITDSL 437 >At5g03800.1 68418.m00347 exostosin family protein / pentatricopeptide (PPR) repeat-containing protein contains Pfam profiles: PF03016 exostosin family, PF01535 PPR repeat Length = 1388 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = -3 Query: 513 PNTKYWLRSVFKILK*TLLFSHRAMNFQLTFGLV 412 PNT+Y L+ V + +K + LF H A +T+G++ Sbjct: 806 PNTEYVLQEVDEFMKKSFLFHHSA-KLAVTYGIL 838 >At2g42000.1 68415.m05195 plant EC metallothionein-like family 15 protein 84 C-terminal residues identical to EC protein homolog 1 (SP:P93746) {Arabidopsis thaliana}; contains Pfam PF02068: Plant PEC family metallothionein profile; Length = 115 Score = 28.3 bits (60), Expect = 5.6 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = -1 Query: 713 HCIPRPCGYPRFQASSTVSKPCCIHGCRC 627 HC PC P+ Q ++ C GC C Sbjct: 82 HCGCNPCNCPKTQTQTSAKGCTCGEGCTC 110 >At5g16590.1 68418.m01942 leucine-rich repeat transmembrane protein kinase, putative Length = 625 Score = 27.9 bits (59), Expect = 7.4 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = -2 Query: 319 LNGVFGEDKSELNWETITDDVLGALEPKLIGVLHAVHLVVSY 194 L+G G +S LNWET + LGA + I LH+ S+ Sbjct: 427 LHGNKGSGRSPLNWETRANIALGA--ARAISYLHSRDATTSH 466 >At2g04620.1 68415.m00470 cation efflux family protein potential member of the cation diffusion facilitator (CDF) family, or cation efflux (CE) family, see PMID:11500563 Length = 798 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = -2 Query: 91 VKLLLQNVVRDVGICSIQRCHEKT*NNYD 5 +K ++N+++ G+CSIQR H + N D Sbjct: 727 LKEAMRNILKTKGVCSIQRLHVWSFTNSD 755 >At1g06550.1 68414.m00694 enoyl-CoA hydratase/isomerase family protein similar to CHY1 [gi:8572760]; contains Pfam profile PF00388 enoyl-CoA hydratase/isomerase family protein Length = 387 Score = 27.9 bits (59), Expect = 7.4 Identities = 32/118 (27%), Positives = 55/118 (46%), Gaps = 4/118 (3%) Frame = +2 Query: 161 SEVITNVVNKLIRNNKMNCMEYAYQLWLQGSKDIVRDCFPVEFRL---IFAENAIKLMYK 331 +E IT V+ L R++ ++ Q +G K + DC EFRL I + MY Sbjct: 263 NEWITPVIKGLKRSSPTG-LKIVLQSIREGRKQTLSDCLKKEFRLTLNILRKTISPDMY- 320 Query: 332 RDGL-ALTLSNDVHGNDGRLAFGDGKDKTSPKVSWKFIALWENNKVYFKILNTERNQY 502 +G+ ALT+ D + D+ K++ F L+E++ + +I TE N++ Sbjct: 321 -EGIRALTIDKDNSPKWNPATLDEVDDE---KINSVF-KLFEDDDIELQIPETEENRW 373 >At5g07400.1 68418.m00847 forkhead-associated domain-containing protein / FHA domain-containing protein Length = 1084 Score = 27.5 bits (58), Expect = 9.8 Identities = 24/80 (30%), Positives = 39/80 (48%), Gaps = 2/80 (2%) Frame = -2 Query: 427 DFRACFVLT--VAEGKSAIVAVNIITQRQSETVALVHKLNGVFGEDKSELNWETITDDVL 254 D R FV+ V EG+ A + V++ + T + + VF ++E+N V Sbjct: 153 DGRVGFVVQEIVFEGRDASI-VSVSSGHSRGTFSSGKRSKRVFAPMENEIN-----SPVS 206 Query: 253 GALEPKLIGVLHAVHLVVSY 194 G PK +GV+ V+ +VSY Sbjct: 207 GFYPPKAVGVVERVNSLVSY 226 >At4g28590.1 68417.m04089 expressed protein Length = 331 Score = 27.5 bits (58), Expect = 9.8 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 325 HKLNGVFGEDKSELNWETITDD 260 H + V G+D SE++WE DD Sbjct: 180 HPIKNVVGDDGSEIDWEGEIDD 201 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,717,425 Number of Sequences: 28952 Number of extensions: 284811 Number of successful extensions: 1118 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 1084 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1118 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1624036432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -