BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30872 (331 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g77800.1 68414.m09059 PHD finger family protein contains Pfam... 29 0.75 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 28 1.7 At4g31850.1 68417.m04525 pentatricopeptide (PPR) repeat-containi... 27 2.3 At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin fa... 27 3.0 At2g45880.1 68415.m05706 glycosyl hydrolase family 14 protein si... 27 4.0 At3g20940.1 68416.m02647 cytochrome P450 family protein similar ... 26 5.3 At3g07100.1 68416.m00845 protein transport protein Sec24, putati... 26 5.3 At5g49130.1 68418.m06081 MATE efflux family protein contains Pfa... 26 7.0 At1g49840.1 68414.m05588 expressed protein contains Pfam profile... 26 7.0 At5g14820.1 68418.m01738 pentatricopeptide (PPR) repeat-containi... 25 9.3 At4g29140.1 68417.m04170 MATE efflux protein-related several hyp... 25 9.3 At3g62540.1 68416.m07026 pentatricopeptide (PPR) repeat-containi... 25 9.3 At3g62470.1 68416.m07018 pentatricopeptide (PPR) repeat-containi... 25 9.3 At3g21380.1 68416.m02699 jacalin lectin family protein similar t... 25 9.3 >At1g77800.1 68414.m09059 PHD finger family protein contains Pfam domain, PF00628: PHD-finger Length = 1423 Score = 29.1 bits (62), Expect = 0.75 Identities = 19/46 (41%), Positives = 27/46 (58%) Frame = +1 Query: 163 SVSSGLALPLALLKSMGEGNHSPSGEPYARLPTRAIKKKKKNSRGG 300 SV S LP+AL + NHS + + + + + A KKKKK+SR G Sbjct: 75 SVLSVPTLPIALANLLK--NHSDNKKRHKKSHSGADKKKKKSSRQG 118 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 27.9 bits (59), Expect = 1.7 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +1 Query: 211 GEGNHSPSGEPYARLPTRAIKKKKKNSRGGPVPNSPYSES 330 G +PS P + +PTR + K + + P PN PY++S Sbjct: 388 GSSQATPSKSP-SPVPTRPVHKPQP-PKESPQPNDPYNQS 425 >At4g31850.1 68417.m04525 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 1112 Score = 27.5 bits (58), Expect = 2.3 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +1 Query: 151 LAGYSVSSGLALPLALLKSMGEGNHSPSGEPYARLPTRA 267 + GYS+S A+ ++M G SP+ Y +LP RA Sbjct: 1074 IRGYSLSGKPEHAYAVYQTMVTGGFSPNTGTYEQLPNRA 1112 >At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin family protein contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 401 Score = 27.1 bits (57), Expect = 3.0 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -1 Query: 229 VSGYPR-PWTSAMPGAEPSRCLPNSRPINPSYSS 131 V G P P +PG P+ +P P++PS+SS Sbjct: 364 VPGLPGIPPVPLIPGIPPAPLIPGIPPLSPSFSS 397 >At2g45880.1 68415.m05706 glycosyl hydrolase family 14 protein similar to beta-amylase GI:13560977 from [Castanea crenata] Length = 691 Score = 26.6 bits (56), Expect = 4.0 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +1 Query: 166 VSSGLALPLALLKSMGEGNHSPSGEPYARLPTRA 267 VSSGL P+ L +G +P+ PY LP ++ Sbjct: 171 VSSGLRSPVELSSCRMKGVFTPAPSPYDMLPIQS 204 >At3g20940.1 68416.m02647 cytochrome P450 family protein similar to Cytochrome P450 93A3 (P450 CP5) (SP:O81973) [Glycine max]; similar to cytochrome P450 (SP:H71417) [Arabidopsis thaliana] Length = 523 Score = 26.2 bits (55), Expect = 5.3 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -1 Query: 205 TSAMPGAEPSRCLPNSRPINPSYSSV 128 T+A+ A+P +C P SR NP SS+ Sbjct: 493 TTALSMAQPLKCTPVSRTKNPLPSSL 518 >At3g07100.1 68416.m00845 protein transport protein Sec24, putative similar to protein transport protein Sec24A (SEC24-related protein) [Homo sapiens] SWISS-PROT:O95486 Length = 1038 Score = 26.2 bits (55), Expect = 5.3 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -1 Query: 232 MVSGYPRPWTSAMPGAEPSRCLPNSRPINPSY 137 M G P P+ S +PG+ P NS P +P+Y Sbjct: 72 MRPGQPSPFVSQIPGSRPPPPSSNSFP-SPAY 102 >At5g49130.1 68418.m06081 MATE efflux family protein contains Pfam profile PF01554: MatE Uncharacterized membrane protein family Length = 502 Score = 25.8 bits (54), Expect = 7.0 Identities = 22/65 (33%), Positives = 31/65 (47%), Gaps = 5/65 (7%) Frame = +1 Query: 55 VIKYLKKKQTYLVCYTHLNENQSA-----IHYYNLD*LAGYSVSSGLALPLALLKSMGEG 219 ++ YLK T +VC L + A I + N+ GYSV SGLA + L G Sbjct: 42 ILNYLKN-MTSVVCMGRLGSLELAGGALAIGFTNI---TGYSVLSGLATGMEPLCGQAIG 97 Query: 220 NHSPS 234 + +PS Sbjct: 98 SKNPS 102 >At1g49840.1 68414.m05588 expressed protein contains Pfam profile PF04788: Protein of unknown function (DUF620) Length = 494 Score = 25.8 bits (54), Expect = 7.0 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -1 Query: 190 GAEPSRCLPNSRPINPSYSSVSH 122 G PSR P SR +PS S+ H Sbjct: 18 GLSPSRSRPRSRSASPSRSTTPH 40 >At5g14820.1 68418.m01738 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 598 Score = 25.4 bits (53), Expect = 9.3 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = +1 Query: 151 LAGYSVSSGLALPLALLKSMGEGNHSPSGEPYARL 255 + G+ L LLK M E H P G+ Y L Sbjct: 409 ITGFGTQKKLDTVYELLKEMQEKGHPPDGKTYNAL 443 >At4g29140.1 68417.m04170 MATE efflux protein-related several hypothetical proteins - Arabidopsis thaliana; contains Pfam profile PF01554: Uncharacterized membrane protein family Length = 532 Score = 25.4 bits (53), Expect = 9.3 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +1 Query: 151 LAGYSVSSGLALPLALLKSMGEGNH 225 + GYSV SGLAL + L S G H Sbjct: 105 ITGYSVLSGLALGMEPLCSQAFGAH 129 >At3g62540.1 68416.m07026 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 599 Score = 25.4 bits (53), Expect = 9.3 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = +1 Query: 151 LAGYSVSSGLALPLALLKSMGEGNHSPSGEPYARL 255 + G+ L LLK M E H P G+ Y L Sbjct: 410 ITGFGTQKKLDTVYELLKEMQEKGHPPDGKTYNAL 444 >At3g62470.1 68416.m07018 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 599 Score = 25.4 bits (53), Expect = 9.3 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = +1 Query: 151 LAGYSVSSGLALPLALLKSMGEGNHSPSGEPYARL 255 + G+ L LLK M E H P G+ Y L Sbjct: 410 ITGFGTQKKLDTVYELLKEMQEKGHPPDGKTYNAL 444 >At3g21380.1 68416.m02699 jacalin lectin family protein similar to myrosinase-binding protein homolog [Arabidopsis thaliana] GI:2997767; contains Pfam profile: PF01419 jacalin-like lectin domain Length = 455 Score = 25.4 bits (53), Expect = 9.3 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = +1 Query: 181 ALPLALLKSMGEGNHSPSGEPYARLPTRAIKKKKKNSRGGPVPN 312 AL S G G S + P + PT + KK ++GG V N Sbjct: 277 ALGAYFAPSSGRGTPSATQPPGSAQPTGSAGAKKLEAKGGNVGN 320 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,895,848 Number of Sequences: 28952 Number of extensions: 128896 Number of successful extensions: 376 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 370 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 376 length of database: 12,070,560 effective HSP length: 71 effective length of database: 10,014,968 effective search space used: 380568784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -