BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30871 (789 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY052624-1|AAL15472.1| 212|Tribolium castaneum kynurenine 3-mon... 23 3.7 AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-mon... 23 3.7 AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-mon... 23 3.7 AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 22 6.4 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 8.5 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 21 8.5 >AY052624-1|AAL15472.1| 212|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 212 Score = 22.6 bits (46), Expect = 3.7 Identities = 12/25 (48%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = +3 Query: 408 GISERRANALQNELEE-SRTLLEQA 479 GI ERR+N + +EE SR +E A Sbjct: 95 GILERRSNDIAGSIEEFSRERVEDA 119 >AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 22.6 bits (46), Expect = 3.7 Identities = 12/25 (48%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = +3 Query: 408 GISERRANALQNELEE-SRTLLEQA 479 GI ERR+N + +EE SR +E A Sbjct: 328 GILERRSNDIAGSIEEFSRERVEDA 352 >AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 22.6 bits (46), Expect = 3.7 Identities = 12/25 (48%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = +3 Query: 408 GISERRANALQNELEE-SRTLLEQA 479 GI ERR+N + +EE SR +E A Sbjct: 328 GILERRSNDIAGSIEEFSRERVEDA 352 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 21.8 bits (44), Expect = 6.4 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 110 RQTHPREGGRIRKHTQEPPA 169 R THP E GR K PA Sbjct: 351 RTTHPNEPGRFAKLLLRLPA 370 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.4 bits (43), Expect = 8.5 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +3 Query: 240 KKLEADINELEIALDHANKANAEAQKNIKRYQAQIKDL 353 KK E E+E DH K N ++K + Y + D+ Sbjct: 213 KKKEVK-EEIEDEPDHKWKKNDSSKKKTRYYYRSVDDV 249 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 21.4 bits (43), Expect = 8.5 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +2 Query: 452 RVPHTLGAGRPRPSPGRA 505 +VP G GR P P R+ Sbjct: 320 QVPQLAGGGRRGPGPARS 337 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,255 Number of Sequences: 336 Number of extensions: 1734 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21376414 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -