BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30866 (785 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory recept... 23 3.7 AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory recept... 23 3.7 U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. 21 8.4 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 21 8.4 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 21 8.4 AF243042-1|AAF68438.1| 126|Tribolium castaneum mutant transcrip... 21 8.4 >AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory receptor candidate 49 protein. Length = 418 Score = 22.6 bits (46), Expect = 3.7 Identities = 12/37 (32%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +3 Query: 3 FKLKFECLF*TSYFWFKSDLYPSNCPALNEIY-YLEE 110 F +F CL SYF++ S +Y + L+ I+ Y+++ Sbjct: 75 FMSRFLCLPFYSYFFYLSYIYTTYSRKLSGIFKYIDQ 111 >AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory receptor candidate 14 protein. Length = 374 Score = 22.6 bits (46), Expect = 3.7 Identities = 12/37 (32%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +3 Query: 3 FKLKFECLF*TSYFWFKSDLYPSNCPALNEIY-YLEE 110 F +F CL SYF++ S +Y + L+ I+ Y+++ Sbjct: 31 FMSRFLCLPFYSYFFYLSYIYTTYSRKLSGIFKYIDQ 67 >U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. Length = 283 Score = 21.4 bits (43), Expect = 8.4 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +2 Query: 197 SHHRPPVH 220 SHH PP+H Sbjct: 91 SHHGPPIH 98 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 21.4 bits (43), Expect = 8.4 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +2 Query: 197 SHHRPPVH 220 SHH PP+H Sbjct: 91 SHHGPPIH 98 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 21.4 bits (43), Expect = 8.4 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +2 Query: 197 SHHRPPVH 220 SHH PP+H Sbjct: 91 SHHGPPIH 98 >AF243042-1|AAF68438.1| 126|Tribolium castaneum mutant transcription factor TcDfd1 protein. Length = 126 Score = 21.4 bits (43), Expect = 8.4 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +2 Query: 197 SHHRPPVH 220 SHH PP+H Sbjct: 91 SHHGPPIH 98 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,853 Number of Sequences: 336 Number of extensions: 3171 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21272645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -