SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= epV30866
         (785 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292370-1|CAL23182.1|  418|Tribolium castaneum gustatory recept...    23   3.7  
AM292335-1|CAL23147.2|  374|Tribolium castaneum gustatory recept...    23   3.7  
U81040-1|AAB39356.1|  283|Tribolium castaneum TC Deformed protein.     21   8.4  
U81038-1|AAB39355.1|  412|Tribolium castaneum transcription fact...    21   8.4  
AF321227-3|AAK16423.1|  412|Tribolium castaneum Dfd protein.           21   8.4  
AF243042-1|AAF68438.1|  126|Tribolium castaneum mutant transcrip...    21   8.4  

>AM292370-1|CAL23182.1|  418|Tribolium castaneum gustatory receptor
           candidate 49 protein.
          Length = 418

 Score = 22.6 bits (46), Expect = 3.7
 Identities = 12/37 (32%), Positives = 22/37 (59%), Gaps = 1/37 (2%)
 Frame = +3

Query: 3   FKLKFECLF*TSYFWFKSDLYPSNCPALNEIY-YLEE 110
           F  +F CL   SYF++ S +Y +    L+ I+ Y+++
Sbjct: 75  FMSRFLCLPFYSYFFYLSYIYTTYSRKLSGIFKYIDQ 111


>AM292335-1|CAL23147.2|  374|Tribolium castaneum gustatory receptor
           candidate 14 protein.
          Length = 374

 Score = 22.6 bits (46), Expect = 3.7
 Identities = 12/37 (32%), Positives = 22/37 (59%), Gaps = 1/37 (2%)
 Frame = +3

Query: 3   FKLKFECLF*TSYFWFKSDLYPSNCPALNEIY-YLEE 110
           F  +F CL   SYF++ S +Y +    L+ I+ Y+++
Sbjct: 31  FMSRFLCLPFYSYFFYLSYIYTTYSRKLSGIFKYIDQ 67


>U81040-1|AAB39356.1|  283|Tribolium castaneum TC Deformed protein.
          Length = 283

 Score = 21.4 bits (43), Expect = 8.4
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +2

Query: 197 SHHRPPVH 220
           SHH PP+H
Sbjct: 91  SHHGPPIH 98


>U81038-1|AAB39355.1|  412|Tribolium castaneum transcription factor
           Deformed protein.
          Length = 412

 Score = 21.4 bits (43), Expect = 8.4
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +2

Query: 197 SHHRPPVH 220
           SHH PP+H
Sbjct: 91  SHHGPPIH 98


>AF321227-3|AAK16423.1|  412|Tribolium castaneum Dfd protein.
          Length = 412

 Score = 21.4 bits (43), Expect = 8.4
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +2

Query: 197 SHHRPPVH 220
           SHH PP+H
Sbjct: 91  SHHGPPIH 98


>AF243042-1|AAF68438.1|  126|Tribolium castaneum mutant
           transcription factor TcDfd1 protein.
          Length = 126

 Score = 21.4 bits (43), Expect = 8.4
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +2

Query: 197 SHHRPPVH 220
           SHH PP+H
Sbjct: 91  SHHGPPIH 98


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 163,853
Number of Sequences: 336
Number of extensions: 3171
Number of successful extensions: 8
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 21272645
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -