BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30866 (785 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16A3.04 |rsm25||mitochondrial ribosomal protein subunit Rsm2... 30 0.43 SPCC1259.03 |rpa12||DNA-directed RNA polymerase complex I subuni... 28 1.3 SPCC18.03 |||shuttle craft like transcriptional regulator|Schizo... 25 9.3 >SPBC16A3.04 |rsm25||mitochondrial ribosomal protein subunit Rsm25|Schizosaccharomyces pombe|chr 2|||Manual Length = 220 Score = 29.9 bits (64), Expect = 0.43 Identities = 16/35 (45%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = +1 Query: 313 YFKIARHPPCTIYRLR*-PLHNTNKVKN*TTQLRK 414 Y +A+HPP Y R PL++ NKVK+ +LRK Sbjct: 28 YETVAKHPPTFQYARRIVPLYDPNKVKSRGKRLRK 62 >SPCC1259.03 |rpa12||DNA-directed RNA polymerase complex I subunit Rpa12|Schizosaccharomyces pombe|chr 3|||Manual Length = 119 Score = 28.3 bits (60), Expect = 1.3 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -3 Query: 288 IALVSSLIFKLECGNCAADCAVQWT 214 ++ + SLIF ECGN QWT Sbjct: 1 MSAIGSLIFCSECGNLLESTTAQWT 25 >SPCC18.03 |||shuttle craft like transcriptional regulator|Schizosaccharomyces pombe|chr 3|||Manual Length = 1077 Score = 25.4 bits (53), Expect = 9.3 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = +2 Query: 170 CCRHVCGAMSHHRPPVHCTAQSAAQLPHSSLKIRL 274 C H C M H P C S +LP + + RL Sbjct: 595 CGNHFCQHMCHRGPCPRCLEASFEELPCTCGRTRL 629 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,766,409 Number of Sequences: 5004 Number of extensions: 47864 Number of successful extensions: 104 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 101 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 104 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 381366860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -