BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30858 (688 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 44 1e-06 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 26 0.39 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 24 1.6 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 6.3 AF134817-1|AAD40233.1| 105|Apis mellifera FABP-like protein pro... 21 8.3 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 8.3 AB083011-1|BAC54132.1| 135|Apis mellifera fatty acid binding pr... 21 8.3 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 44.0 bits (99), Expect = 1e-06 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = +1 Query: 343 PCLKVHCSAGRVCEINEHGD-AMCNCIKDCPYETDSRRMVCTNFNETWQSDCEVYRQRC 516 PC +C G+ CE++ + A+C C++ CP R VC + + + + CE++R C Sbjct: 81 PCASKYCGIGKECELSPNSTIAVCVCMRKCPRR---HRPVCASNGKIYANHCELHRAAC 136 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 25.8 bits (54), Expect = 0.39 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 373 RVCEINEHGDAMCNCIKDCPYETDSRRMVCTNFNET 480 +VC H D+ C C+ DS V NFNE+ Sbjct: 344 QVCRSRRHSDSCCLCL-------DSMNAVIRNFNES 372 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 23.8 bits (49), Expect = 1.6 Identities = 10/33 (30%), Positives = 14/33 (42%) Frame = +1 Query: 364 SAGRVCEINEHGDAMCNCIKDCPYETDSRRMVC 462 + G C EH + DC E +RR +C Sbjct: 296 TTGTKCVSGEHLSVSGGALNDCHAEVVARRCLC 328 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.8 bits (44), Expect = 6.3 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 Query: 574 EYYGTCREMPDCTESEMSDFPRRMRD 651 +Y + MPD E+E+SD +RD Sbjct: 74 QYARVQQSMPDGWETEISDQMLELRD 99 >AF134817-1|AAD40233.1| 105|Apis mellifera FABP-like protein protein. Length = 105 Score = 21.4 bits (43), Expect = 8.3 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -3 Query: 548 PRH*SELSRHKHRWRYTSQS 489 PR ELS++ W +TS S Sbjct: 33 PRPSFELSKNGDEWTFTSSS 52 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.4 bits (43), Expect = 8.3 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -1 Query: 208 QPPRCPRGR 182 QPP+CPR R Sbjct: 564 QPPQCPRFR 572 >AB083011-1|BAC54132.1| 135|Apis mellifera fatty acid binding protein protein. Length = 135 Score = 21.4 bits (43), Expect = 8.3 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -3 Query: 548 PRH*SELSRHKHRWRYTSQS 489 PR ELS++ W +TS S Sbjct: 35 PRPSFELSKNGDEWTFTSSS 54 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,989 Number of Sequences: 438 Number of extensions: 3286 Number of successful extensions: 10 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20952180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -