BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30857 (660 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 pr... 25 1.6 AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR prot... 24 4.9 AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase ... 23 6.5 >AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 protein. Length = 507 Score = 25.4 bits (53), Expect = 1.6 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = +3 Query: 60 GINVNEHLSQVGGSLSAGSE*FSTTV-LLLYCDTQSCVLAGNIR*DI 197 G+ +NE +QV S AGSE STT+ LY ++ + G +R +I Sbjct: 295 GLTMNELAAQVFVSFLAGSETSSTTMNFCLYELAKNPDIQGRLREEI 341 >AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR protein. Length = 502 Score = 23.8 bits (49), Expect = 4.9 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -1 Query: 624 VFATDVNCNFMEFSSILCFF 565 ++ ++ C F FSS LC F Sbjct: 185 IYIQEICCRFFTFSSSLCCF 204 >AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase protein. Length = 849 Score = 23.4 bits (48), Expect = 6.5 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 202 KRRALEVLKLLPQRAMRLSSFHYDVFFLF 288 K+R VL+ LPQ + F Y VF +F Sbjct: 560 KKRISIVLEFLPQIIFLVLLFAYMVFMMF 588 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 672,715 Number of Sequences: 2352 Number of extensions: 12662 Number of successful extensions: 26 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65650335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -