BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30856 (738 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 22 6.9 AF393496-1|AAL60421.1| 146|Apis mellifera odorant binding prote... 22 6.9 AF339140-1|AAK01304.1| 120|Apis mellifera odorant binding prote... 22 6.9 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 21.8 bits (44), Expect = 6.9 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +1 Query: 352 MKIKTDYFSEKQMMYRNPLLYEQLVGQYLTDEEIKER 462 + I D +K+ + + L+ G LTD+E+KE+ Sbjct: 305 LDIDDDVGEKKRQAFLDLLIEAGQNGVLLTDKEVKEQ 341 >AF393496-1|AAL60421.1| 146|Apis mellifera odorant binding protein ASP6 protein. Length = 146 Score = 21.8 bits (44), Expect = 6.9 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -2 Query: 116 GCSLAWEFLKDIF 78 GC +AW+F K I+ Sbjct: 124 GCEVAWQFGKCIY 136 >AF339140-1|AAK01304.1| 120|Apis mellifera odorant binding protein protein. Length = 120 Score = 21.8 bits (44), Expect = 6.9 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -2 Query: 116 GCSLAWEFLKDIF 78 GC +AW+F K I+ Sbjct: 98 GCEVAWQFGKCIY 110 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,126 Number of Sequences: 438 Number of extensions: 3698 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23023035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -