BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30854 (330 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11300| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.17 SB_34508| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.23 SB_19792| Best HMM Match : SspH (HMM E-Value=6.6) 30 0.40 SB_25427| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.52 SB_52191| Best HMM Match : zf-CCHC (HMM E-Value=0.0016) 29 0.69 SB_11546| Best HMM Match : DUF1407 (HMM E-Value=1.2) 29 0.92 SB_31699| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_18560| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.6 SB_40142| Best HMM Match : DUF827 (HMM E-Value=1.2) 28 1.6 SB_6235| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.1 SB_1476| Best HMM Match : RVT_1 (HMM E-Value=5.49309e-43) 28 2.1 SB_32601| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.1 SB_25388| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.1 SB_8336| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.84) 27 3.7 SB_42859| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.9 SB_38546| Best HMM Match : Trypsin (HMM E-Value=1.90577e-43) 27 4.9 SB_34393| Best HMM Match : RVT_1 (HMM E-Value=2e-36) 27 4.9 SB_20246| Best HMM Match : RVT_1 (HMM E-Value=1.4e-30) 27 4.9 SB_40710| Best HMM Match : RVT_1 (HMM E-Value=1.7e-25) 27 4.9 SB_10763| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.9 SB_7820| Best HMM Match : zf-HYPF (HMM E-Value=2.5) 27 4.9 SB_53804| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 6.5 SB_50497| Best HMM Match : CH (HMM E-Value=0.0084) 26 6.5 SB_39550| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 6.5 SB_8208| Best HMM Match : ShTK (HMM E-Value=1.2e-21) 26 6.5 SB_3407| Best HMM Match : TPX2 (HMM E-Value=2.9e-09) 26 6.5 SB_21616| Best HMM Match : RVT_1 (HMM E-Value=0.00011) 26 6.5 SB_21584| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 6.5 SB_7017| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 6.5 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 26 8.5 SB_17775| Best HMM Match : Coiled (HMM E-Value=2.3) 26 8.5 SB_15028| Best HMM Match : Drf_FH1 (HMM E-Value=0.84) 26 8.5 SB_39091| Best HMM Match : dsDNA_bind (HMM E-Value=2.3) 26 8.5 SB_37791| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.5 SB_37674| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.5 SB_36237| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.5 SB_34652| Best HMM Match : Ank (HMM E-Value=3.8e-34) 26 8.5 SB_17350| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.5 >SB_11300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1148 Score = 31.5 bits (68), Expect = 0.17 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 4/60 (6%) Frame = +3 Query: 18 GLPDAATELSAPVATKVFTAPT-SKRPAPTPKPMKQSDAKPKGKQTTFVNSLHE---EHI 185 G+ + + +T P S P P PM++ KP+G +T F+ L E EHI Sbjct: 307 GMDTQGSSQQGTLPITAYTRPNCSLEPPPPDMPMQKQKEKPEGCRTVFIGGLPESINEHI 366 >SB_34508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 31.1 bits (67), Expect = 0.23 Identities = 18/69 (26%), Positives = 28/69 (40%) Frame = +3 Query: 3 ALQEDGLPDAATELSAPVATKVFTAPTSKRPAPTPKPMKQSDAKPKGKQTTFVNSLHEEH 182 A QE P E A P P P KP + +AKP+ KQ T + + +E Sbjct: 123 AKQEAPQPIKPAEKPPKPAAAKEPVPVKPEPKPETKPEAKQEAKPEAKQVTKPSPIVQEE 182 Query: 183 IQQSNSFKR 209 ++ + + Sbjct: 183 APRTQAIPK 191 >SB_19792| Best HMM Match : SspH (HMM E-Value=6.6) Length = 244 Score = 30.3 bits (65), Expect = 0.40 Identities = 25/87 (28%), Positives = 33/87 (37%), Gaps = 1/87 (1%) Frame = +2 Query: 71 HSADQQEASAYTETDEAVRRETERKTNDLRKFTTRRTHSTVEFIQTPHVQCTWGHRILRM 250 H D Q A YT+ + + + R +T S I T HV + RI Sbjct: 100 HVIDSQTARIYTQHTARIYIQHVNDSQTARIYTNHMNDSQTARIYTQHVNDSKTARIYTQ 159 Query: 251 RRVTSFSALT-TARCS*LCGNNTINHH 328 S +A T T R S CG T + H Sbjct: 160 HVSDSQTARTFTQRASTTCGRLTDSAH 186 >SB_25427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1198 Score = 29.9 bits (64), Expect = 0.52 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +2 Query: 89 EASAYTETDEAVRRETERKTNDLRKFTTRRTHSTVEFIQTPHV 217 E S+Y DEA +R ++ + +KF++ + ST F H+ Sbjct: 158 ERSSYLHDDEARKRAIQQLLDSTKKFSSNASRSTTSFSSKYHL 200 >SB_52191| Best HMM Match : zf-CCHC (HMM E-Value=0.0016) Length = 529 Score = 29.5 bits (63), Expect = 0.69 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +1 Query: 181 TFNSRIHSNASCSMYLGTPNSKDATRDLLQRTNDC 285 T +S++H C + PNS D +R R DC Sbjct: 201 TTDSKLHRTPDCRSHRTPPNSPDVSRQSSIRVRDC 235 >SB_11546| Best HMM Match : DUF1407 (HMM E-Value=1.2) Length = 367 Score = 29.1 bits (62), Expect = 0.92 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -3 Query: 181 CSSCSEFTKVVCFPFGFASDCFIGF 107 C SC+ V+ F FG++S CF+ F Sbjct: 151 CISCNYLGSVIAFSFGYSS-CFVNF 174 >SB_31699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6119 Score = 28.7 bits (61), Expect = 1.2 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 7/48 (14%) Frame = +3 Query: 6 LQEDGLPDAATEL----SAPVATKVFTA---PTSKRPAPTPKPMKQSD 128 ++ED L TE+ + P TK+ T P+ + PAP PKP+ S+ Sbjct: 4609 IEEDELDAEPTEVEPAPAEPTPTKIQTEVSKPSKREPAPAPKPVFASE 4656 >SB_18560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1937 Score = 28.3 bits (60), Expect = 1.6 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +3 Query: 81 TSKRPAPTPKPMKQSDAKPKGKQTTFVNSLHEEHI 185 T+ RP PT +P Q+ ++P+G Q V HE + Sbjct: 466 TTVRPQPTDRPRPQTTSRPQGTQCGAV-KCHERGV 499 >SB_40142| Best HMM Match : DUF827 (HMM E-Value=1.2) Length = 334 Score = 28.3 bits (60), Expect = 1.6 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +3 Query: 48 APVATKVFTAPTSKRPAPTPKPMKQSDA 131 A +T +PTS+ P P P+P K+SD+ Sbjct: 191 ATPSTPSTPSPTSETPRPRPQPPKRSDS 218 >SB_6235| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 181 Score = 27.9 bits (59), Expect = 2.1 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +2 Query: 107 ETDEAVRRETERKTNDLRKFTTRRT-HSTVEFIQTPH 214 ++D+ E + T DLR+ TTRRT +S Q PH Sbjct: 126 DSDDDEEEEEDDVTYDLRQVTTRRTPYSRCPCSQEPH 162 >SB_1476| Best HMM Match : RVT_1 (HMM E-Value=5.49309e-43) Length = 1078 Score = 27.9 bits (59), Expect = 2.1 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -3 Query: 181 CSSCSEFTKVVCFPFGFASDCFIGF 107 C SC+ V+ F FG++S CF+ F Sbjct: 758 CISCNYLGSVIAFFFGYSS-CFVNF 781 >SB_32601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 292 Score = 27.9 bits (59), Expect = 2.1 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = -2 Query: 227 KYIEHEAFE*IRLLNVFFV**IYEGRLFSFRFRVGLLHR--FRCRR 96 K ++H ++ +RL+N +Y R+ FR +G L R F CRR Sbjct: 230 KSVQHRVYQFLRLMNSMVNPLVYVCRMKEFRRTLGYLLRLVFCCRR 275 >SB_25388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 27.9 bits (59), Expect = 2.1 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = +3 Query: 39 ELSAPVATKVFTAPTS--KRPAPTPKPMKQSDAKPKGKQTT 155 EL PVA PT+ + P+P+P K S K KQ T Sbjct: 142 ELPPPVAISAAAVPTAAPQEATPSPEPPKLSVLKESPKQDT 182 >SB_8336| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.84) Length = 509 Score = 27.1 bits (57), Expect = 3.7 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +3 Query: 45 SAPVATKVFTAPTSKRPAPTPKPMKQSDAKPKGKQT 152 + P AT T PT+ P T P K + P G T Sbjct: 95 TTPPATTTPTKPTTTTPPATTTPTKPTTTTPPGTTT 130 >SB_42859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1370 Score = 26.6 bits (56), Expect = 4.9 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +3 Query: 3 ALQEDGLPDAATELSAPVATKVFTAPTSKRPAPTPKPMKQSD 128 A+ + P A ++AP + P + P PTP M++SD Sbjct: 396 AINTETKPIGAHNMAAPGRSSPSFFPMALSPLPTPLAMEESD 437 >SB_38546| Best HMM Match : Trypsin (HMM E-Value=1.90577e-43) Length = 506 Score = 26.6 bits (56), Expect = 4.9 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +3 Query: 24 PDAATELSAPVATKVFTAPTSKRPAPTPKPMKQSDAKPKG 143 PDA T P K APT P P P +KP G Sbjct: 221 PDAPTP---PPPVKTTAAPTPSPPQTPPPPTGSCGSKPSG 257 >SB_34393| Best HMM Match : RVT_1 (HMM E-Value=2e-36) Length = 1198 Score = 26.6 bits (56), Expect = 4.9 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +3 Query: 30 AATELSAPVATKVFTAPTSKRPAPTPKPMKQSDAKPK 140 AAT+ AP+ + +T P + + +P P++Q K Sbjct: 1116 AATQYRAPILPERYTTPEAIQSQSSPLPVQQPSVSEK 1152 >SB_20246| Best HMM Match : RVT_1 (HMM E-Value=1.4e-30) Length = 1191 Score = 26.6 bits (56), Expect = 4.9 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +3 Query: 30 AATELSAPVATKVFTAPTSKRPAPTPKPMKQSDAKPK 140 AAT+ AP+ + +T P + + +P P++Q K Sbjct: 1114 AATQYRAPILPERYTTPEAIQSQSSPLPVQQPSVSDK 1150 >SB_40710| Best HMM Match : RVT_1 (HMM E-Value=1.7e-25) Length = 736 Score = 26.6 bits (56), Expect = 4.9 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +3 Query: 30 AATELSAPVATKVFTAPTSKRPAPTPKPMKQSDAKPK 140 AAT+ AP+ + +T P + + +P P++Q K Sbjct: 654 AATQYRAPILPERYTTPEAIQSQSSPLPVQQPSVSEK 690 >SB_10763| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 260 Score = 26.6 bits (56), Expect = 4.9 Identities = 16/57 (28%), Positives = 26/57 (45%), Gaps = 2/57 (3%) Frame = +3 Query: 30 AATELSAPVATKVFTAPTSKRP--APTPKPMKQSDAKPKGKQTTFVNSLHEEHIQQS 194 AAT PVA P ++P A +P P + + A P ++++S E +S Sbjct: 102 AATTAGKPVAAAAKDLPEVRKPATASSPAPSQPAAATPSDAAASWLSSAKAEAASES 158 >SB_7820| Best HMM Match : zf-HYPF (HMM E-Value=2.5) Length = 307 Score = 26.6 bits (56), Expect = 4.9 Identities = 15/52 (28%), Positives = 27/52 (51%) Frame = +3 Query: 18 GLPDAATELSAPVATKVFTAPTSKRPAPTPKPMKQSDAKPKGKQTTFVNSLH 173 G +AT + +T T P++ APT P+ + +AK + Q T + +L+ Sbjct: 175 GGASSATPSATTASTAPPTTPSTTTLAPT-TPLSEKEAKKQEAQATVLTNLY 225 >SB_53804| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 26.2 bits (55), Expect = 6.5 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +3 Query: 93 PAPTPKPMKQSDAKPKGKQTTFVNSLHEEHIQQSNSFKRL 212 P P+ P K S + GK+ T SL H ++ ++KRL Sbjct: 181 PPPSKSPKKSSPKRKSGKRKT---SLKFSHKKRQKAWKRL 217 >SB_50497| Best HMM Match : CH (HMM E-Value=0.0084) Length = 2086 Score = 26.2 bits (55), Expect = 6.5 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +3 Query: 33 ATELSAPVATKVFTAPTSKRPAPTPKPMKQSDAKP 137 A + P + K +A T+ RPA T K + S KP Sbjct: 1769 ANGAAKPDSVKPSSAKTTTRPASTTKKLATSSTKP 1803 >SB_39550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 26.2 bits (55), Expect = 6.5 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +3 Query: 24 PDAATELSAPVATKVFTAPTSKRPAPT 104 P A T+ + AT T PT K P PT Sbjct: 61 PTAPTQTTPTPATPTPTTPTPKTPTPT 87 >SB_8208| Best HMM Match : ShTK (HMM E-Value=1.2e-21) Length = 226 Score = 26.2 bits (55), Expect = 6.5 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = +3 Query: 6 LQEDGLPDAATELSAPVATKVFTAPTSKRPAPTPK 110 +QE + T + P TK TAPT K PAP PK Sbjct: 193 IQEPPVTKTTTAPTEPPVTKTTTAPT-KAPAP-PK 225 >SB_3407| Best HMM Match : TPX2 (HMM E-Value=2.9e-09) Length = 787 Score = 26.2 bits (55), Expect = 6.5 Identities = 16/48 (33%), Positives = 21/48 (43%) Frame = +3 Query: 75 APTSKRPAPTPKPMKQSDAKPKGKQTTFVNSLHEEHIQQSNSFKRLMF 218 AP +K+P T +PK K T V HEE + + R MF Sbjct: 268 APKAKKPLLTLPSTPNVLKRPKMKPKTHVEKTHEEQELEEINKMREMF 315 >SB_21616| Best HMM Match : RVT_1 (HMM E-Value=0.00011) Length = 1380 Score = 26.2 bits (55), Expect = 6.5 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +3 Query: 30 AATELSAPVATKVFTAPTSKRPAPTPKPMKQSDAKPK 140 AAT+ AP+ + +T P + + +P P++Q K Sbjct: 1154 AATQYRAPILPERYTIPEAIQSQSSPLPVQQPSVSEK 1190 >SB_21584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1750 Score = 26.2 bits (55), Expect = 6.5 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +3 Query: 72 TAPTSKRPAPTPKPMKQSDAKPKGKQTTFVNSLHEEHIQQ 191 T+PT P P P P + + +G +N L E H+ + Sbjct: 1352 TSPTRSSPRPPPSPSVTAATRAQGGLGRQMNVLMELHLNK 1391 >SB_7017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1017 Score = 26.2 bits (55), Expect = 6.5 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +3 Query: 30 AATELSAPVATKVFTAPTSKRPAPTPKPMKQSDAKPK 140 AAT+ AP+ + +T P + + +P P++Q K Sbjct: 935 AATQYRAPILPERYTIPEAIQSQSSPLPVQQPSVSDK 971 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 25.8 bits (54), Expect = 8.5 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +3 Query: 24 PDAATELSAPVATKVFTAPTSKRPAPTPKPMKQSDAKPKGKQ 149 PD +EL+ +TK P + P PTP+P ++ K K K+ Sbjct: 666 PDKTSELTE--STK---RPAADAPPPTPEPSLPTEKKKKEKR 702 >SB_17775| Best HMM Match : Coiled (HMM E-Value=2.3) Length = 877 Score = 25.8 bits (54), Expect = 8.5 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 230 PKYIEHEAFE*IRLL 186 P YIEH+AF IRLL Sbjct: 240 PLYIEHDAFRWIRLL 254 >SB_15028| Best HMM Match : Drf_FH1 (HMM E-Value=0.84) Length = 944 Score = 25.8 bits (54), Expect = 8.5 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +3 Query: 33 ATELSAPVATKVFTAPTSKRPAPTPKPMKQSDAKP 137 A + P + K +A T+ RPA T K + S KP Sbjct: 627 ANGAAKPDSLKPSSAKTTTRPASTTKKLATSSTKP 661 >SB_39091| Best HMM Match : dsDNA_bind (HMM E-Value=2.3) Length = 227 Score = 25.8 bits (54), Expect = 8.5 Identities = 13/49 (26%), Positives = 27/49 (55%) Frame = +3 Query: 45 SAPVATKVFTAPTSKRPAPTPKPMKQSDAKPKGKQTTFVNSLHEEHIQQ 191 S+P ++ F +P KRP+ T + + KP+ + T + +E+ +Q+ Sbjct: 68 SSPATSRPFVSPVLKRPSQT-QGNHPTTKKPRQETITGHDDKNEKELQK 115 >SB_37791| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 264 Score = 25.8 bits (54), Expect = 8.5 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +2 Query: 128 RETERKTNDLRKFTTRRTHSTVEFIQTPHVQCTWGH 235 R +KTN T + VE+I TP Q +GH Sbjct: 52 RRKRQKTNGDDNVATSLVNRMVEYIATPIRQAIFGH 87 >SB_37674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 575 Score = 25.8 bits (54), Expect = 8.5 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = +3 Query: 39 ELSAPVATKV-FTAPTSKRPAPTPKPMKQSDAKP 137 E S P K T+PT PA P+P ++S AKP Sbjct: 534 EASKPETAKPEATSPTDGEPAK-PEPAEESSAKP 566 >SB_36237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 527 Score = 25.8 bits (54), Expect = 8.5 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +3 Query: 30 AATELSAPVATKVFTAPTSKRPAPTPKPMKQSDAKPK 140 AA + AP+ + +TAP + + +P P++Q K Sbjct: 445 AAIQYRAPILPERYTAPEAIQSQSSPLPVQQPSVSDK 481 >SB_34652| Best HMM Match : Ank (HMM E-Value=3.8e-34) Length = 1330 Score = 25.8 bits (54), Expect = 8.5 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +3 Query: 30 AATELSAPVATKVFTAPTSKRPAPTPKPMKQSDAKPK 140 AAT+ AP+ + +T P + + +P P++Q K Sbjct: 263 AATQYRAPILPERYTTPEAIQIQSSPLPVQQPSVSDK 299 >SB_17350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2956 Score = 25.8 bits (54), Expect = 8.5 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 78 PTSKRPAPTPKPMKQSDAKPK 140 PT+K PTP P +D KP+ Sbjct: 2340 PTAKVTWPTPVPQDNADRKPR 2360 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,399,542 Number of Sequences: 59808 Number of extensions: 154080 Number of successful extensions: 822 Number of sequences better than 10.0: 38 Number of HSP's better than 10.0 without gapping: 761 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 817 length of database: 16,821,457 effective HSP length: 72 effective length of database: 12,515,281 effective search space used: 463065397 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -