BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= epV30853 (787 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146759-1|AAO12074.1| 356|Anopheles gambiae odorant-binding pr... 28 0.38 Y08163-1|CAA69355.1| 192|Anopheles gambiae hypothetical protein... 26 1.5 AY752909-1|AAV30083.1| 92|Anopheles gambiae peroxidase 14 prot... 24 6.1 AY645021-1|AAT92557.1| 163|Anopheles gambiae even-skipped protein. 23 8.1 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 23 8.1 AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 pr... 23 8.1 AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. 23 8.1 >AY146759-1|AAO12074.1| 356|Anopheles gambiae odorant-binding protein AgamOBP45 protein. Length = 356 Score = 27.9 bits (59), Expect = 0.38 Identities = 20/43 (46%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +1 Query: 34 ETRFRLHTMPARNKDQEQEVLTWISDVLGEPLPNGAYE-DVLR 159 ET RLH + DQ EV DVLGE L YE DVL+ Sbjct: 236 ETEARLHKLRGSTGDQCTEVYLAYRDVLGE-LGRAYYEYDVLQ 277 >Y08163-1|CAA69355.1| 192|Anopheles gambiae hypothetical protein protein. Length = 192 Score = 25.8 bits (54), Expect = 1.5 Identities = 16/50 (32%), Positives = 25/50 (50%) Frame = -3 Query: 221 WIFFTDPGANLLANLQRITPSLSTSSYAPFGSGSPKTSEIQVRTSCSWSL 72 WI T+ GA+ L IT L + PF + K++ I + + SW+L Sbjct: 125 WIGATNIGASNTNKLTWITTDLPVQTKPPFLNVVAKSTCIALTPTGSWTL 174 >AY752909-1|AAV30083.1| 92|Anopheles gambiae peroxidase 14 protein. Length = 92 Score = 23.8 bits (49), Expect = 6.1 Identities = 14/41 (34%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = -1 Query: 163 RPLAHPRMRHLVAALPKHQRSK*EPL---VLGPCFWQALCA 50 RPLAHP H + P R + +P G +W L A Sbjct: 39 RPLAHPEHVHAGGSAPPVHREQCQPARGHFGGGLWWAGLAA 79 >AY645021-1|AAT92557.1| 163|Anopheles gambiae even-skipped protein. Length = 163 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = -3 Query: 209 TDPGANLLANLQRITPSLSTSSYAPFGSGSPKT 111 T PG N +T S+ S YAP +T Sbjct: 28 TTPGVYSAPNSMLVTGSMPPSPYAPLSMSKSQT 60 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/30 (36%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = +2 Query: 467 NFGPTTLNLT-SKWASIRAPPSPVMVASVT 553 N GP + +T +++ APPSP++ A++T Sbjct: 1931 NDGPLSTGVTIAEYGHWVAPPSPMVRANIT 1960 >AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 protein. Length = 492 Score = 23.4 bits (48), Expect = 8.1 Identities = 9/31 (29%), Positives = 14/31 (45%) Frame = -3 Query: 215 FFTDPGANLLANLQRITPSLSTSSYAPFGSG 123 +F DP + T + +Y PFG+G Sbjct: 404 YFPDPELHSPERFDEATKNYDADAYYPFGAG 434 >AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. Length = 786 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -2 Query: 585 EKFRSNLHVAGVTEATMTGLGGALIEAHLE 496 + RSN+ VA +E + G+G LI+ +E Sbjct: 164 QSLRSNVTVADGSENRVEGVGDCLIKCAVE 193 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 892,189 Number of Sequences: 2352 Number of extensions: 19772 Number of successful extensions: 31 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 82328994 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -